DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp99A and PTPRK

DIOPT Version :10

Sequence 1:NP_651691.4 Gene:Ptp99A / 43469 FlyBaseID:FBgn0004369 Length:1397 Species:Drosophila melanogaster
Sequence 2:NP_001278910.1 Gene:PTPRK / 5796 HGNCID:9674 Length:1462 Species:Homo sapiens


Alignment Length:140 Identity:29/140 - (20%)
Similarity:50/140 - (35%) Gaps:41/140 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 AHRMVLGNFSMYFANIFDKLNVPQNSNTYIVLPGSISHQTMQILMQYMYTGQSSVPEYNVDDVLR 234
            :||....:||...:::|.:.||            ..:.:.:..|.:....|        ||..|.
Human    51 SHRRATSSFSQSVSSLFGEDNV------------RAAQKLLSRLTERFVQG--------VDMFLE 95

  Fly   235 S-----GELLKIRGFWSESRSGGQQQGSGLAGNKRRMPGAEP--PRKMHYRQPGTSSQ-----DS 287
            :     .|||::.|.   ..:||:....|..|:      .||  .|:...|.|...:|     .:
Human    96 TLWKVWMELLEVLGL---DDNGGRACSDGDLGH------LEPLEARRGQKRLPRVLTQCPTCHST 151

  Fly   288 NDQGRAPVLP 297
            :.|.:.|..|
Human   152 SAQPQCPTAP 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp99ANP_651691.4 FN3 140..236 CDD:238020 12/70 (17%)
FN3 243..337 CDD:238020 14/62 (23%)
fn3 343..430 CDD:394996
FN3 442..520 CDD:238020
R5-PTPc-1 704..907 CDD:350397
R5-PTP-2 989..1182 CDD:350398
PTPRKNP_001278910.1 MAM 32..192 CDD:214533 29/140 (21%)
IG_like 202..288 CDD:214653
Ig strand B 212..216 CDD:409353
Ig strand C 226..232 CDD:409353
Ig strand E 253..257 CDD:409353
Ig strand F 267..272 CDD:409353
fn3 294..371 CDD:394996
fn3 488..583 CDD:394996
PTP_DSP_cys 888..1166 CDD:475123
R-PTPc-K-2 1252..1457 CDD:350484
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.