DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Ptp99A and MYLK

DIOPT Version :9

Sequence 1:	NP_651691.4	Gene:	Ptp99A / 43469	FlyBaseID:	FBgn0004369	Length:	1397	Species:	Drosophila melanogaster
Sequence 2:	XP_024309300.1	Gene:	MYLK / 4638	HGNCID:	7590	Length:	1924	Species:	Homo sapiens

Alignment Length:	114	Identity:	41/114 - (35%)
Similarity:	58/114 - (50%)	Gaps:	6/114 - (5%)

- Green bases have known domain annotations that are detailed below.

  Fly   129 EAIVDLLVQDVPDPPE-RPLLISFTSRSVNLSWAHSQHPRNAPVTHFIIETREGEDGIWEQLARI 192
            :|.|:|.|.|.||||. .|......|.|:.|||..|.:...:.|..:.||..:..:..|::||
Human  1330 QAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELA-- 1392

  Fly   193 YTKTNATSYQVTGLTPFTVYSFRLLAVNKLGISPPSKESYYIVTLREAP 241
              ...:||:.|..|.|...|.||:.|:|..|.|.||:|| .:.|:.|.|
Human  1393 --TCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQES-ELTTVGEKP 1438

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Ptp99A	NP_651691.4	FN3	140..236	CDD:238020	33/96 (34%)
		fn3	249..331	CDD:278470
		FN3	342..437	CDD:238020
		FN3	442..520	CDD:238020
		PTPc	646..911	CDD:214550
		PTPc	676..911	CDD:238006
		PTPc	935..1186	CDD:214550
		PTPc	963..1169	CDD:238006
MYLK	XP_024309300.1	I-set	43..133	CDD:254352
		I-set	171..260	CDD:254352
		23ISL	261..422	CDD:318761
		I-set	424..514	CDD:254352
		I-set	524..610	CDD:254352
		I-set	633..722	CDD:254352
		I-set	731..819	CDD:254352
		I-set	1108..1197	CDD:254352
		Ig8_hMLCK_like	1248..1345	CDD:143239	8/14 (57%)
		FN3	1341..1433	CDD:238020	33/96 (34%)
		STKc_MLCK1	1471..1729	CDD:271093
		I-set	1819..1909	CDD:254352
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG0613
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900