DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Ptp99A and B0280.17

DIOPT Version :9

Sequence 1:	NP_651691.4	Gene:	Ptp99A / 43469	FlyBaseID:	FBgn0004369	Length:	1397	Species:	Drosophila melanogaster
Sequence 2:	NP_001040836.2	Gene:	B0280.17 / 4363051	WormBaseID:	WBGene00044674	Length:	260	Species:	Caenorhabditis elegans

Alignment Length:	137	Identity:	32/137 - (23%)
Similarity:	56/137 - (40%)	Gaps:	46/137 - (33%)

- Green bases have known domain annotations that are detailed below.

  Fly   852 HCSAGVGRTGTYIVLDAMLKQIQ-QKNIVNVFGFLRHIRAQRNFLVQTEEQYIFLHDALVEAIAS 915
            :||     ||:|  ||.:||::| ..||......:: .|...|.||: |.:.::..:.:|..:.|
Worm     9 NCS-----TGSY--LDDLLKELQIMTNIYESNDSVK-FRNAHNLLVR-EIKRVYDAEMIVNGLGS 64

  Fly   916 GETNLMAEQVEELKNCTPYLEQQYKNIIQFQPKDIHIASAMK----QVNSIKNRGAIFPIEGSRV 976
            |               ||            .|..:..|:|.|    .::|::|.     ::...:
Worm    65 G---------------TP------------PPSFLGRANAGKDESMDLSSLRNL-----LKDDPL 97

  Fly   977 HLTPKPG 983
            .:||.||
Worm    98 LMTPPPG 104

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Ptp99A	NP_651691.4	FN3	140..236	CDD:238020
		fn3	249..331	CDD:278470
		FN3	342..437	CDD:238020
		FN3	442..520	CDD:238020
		PTPc	646..911	CDD:214550	17/59 (29%)
		PTPc	676..911	CDD:238006	17/59 (29%)
		PTPc	935..1186	CDD:214550	10/53 (19%)
		PTPc	963..1169	CDD:238006	5/21 (24%)
B0280.17	NP_001040836.2	KH-I	141..260	CDD:381803
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0789
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900