DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp99A and Ptpmeg2

DIOPT Version :9

Sequence 1:NP_651691.4 Gene:Ptp99A / 43469 FlyBaseID:FBgn0004369 Length:1397 Species:Drosophila melanogaster
Sequence 2:NP_572576.1 Gene:Ptpmeg2 / 31907 FlyBaseID:FBgn0028341 Length:827 Species:Drosophila melanogaster


Alignment Length:302 Identity:113/302 - (37%)
Similarity:173/302 - (57%) Gaps:33/302 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   628 PVNEFAKHVASLHADGDIGFSREYEAIQNECISDDLPCEHSQHPENKRKNRYLNITAYDHSRVHL 692
            |:::..:.|..   .|..|..:||..|:|.  :.:....|::...|..||||.::..||||||.|
  Fly   517 PIDQIVQMVKQ---RGRHGLIKEYADIRNR--APEGTFLHARMRANLTKNRYTDVLCYDHSRVVL 576

  Fly   693 HPTPGQKKNLDYINANFIDGYQKGHAFIGTQGPLPDTFDCFWRMIWEQRVAIIVMITNLVERGRR 757
            ....|.:.: |||||||:|||::.:|:|.||||||.|...||||||||...:|||.|.::||||.
  Fly   577 AHEDGDEPS-DYINANFVDGYKQKNAYISTQGPLPKTSQDFWRMIWEQHCLVIVMTTRVMERGRV 640

  Fly   758 KCDMYW--PKDGVETYGVIQVKLIEEEVMSTYTVRTLQIKHLKLKKKKQCNTEKL--VYQYHYTN 818
            ||..||  .::....:|...|:.|..|....|.|.:|:::::|        |:::  |..:.:|:
  Fly   641 KCGQYWEPTEESSLEFGDYHVRTISVECNEDYMVASLELRNIK--------TDEIRNVSHWQFTS 697

  Fly   819 WPDHGTPDHPLPVLNFVKK--------------SSAANPAEAGPIVVHCSAGVGRTGTYIVLDAM 869
            |||:|.|...:.:|||::|              :.|.:| ...|||||||||:|||||:|.||..
  Fly   698 WPDYGVPSSAMAMLNFLQKVREKQAQLVQGLGDTWAGHP-RGPPIVVHCSAGIGRTGTFITLDIC 761

  Fly   870 LKQIQQKNIVNVFGFLRHIRAQRNFLVQTEEQYIFLHDALVE 911
            :.:::.....::.|.:..||:||.:.:|..:||:|.|.||:|
  Fly   762 ISRLEDVGTADIRGTVEKIRSQRAYSIQMPDQYVFCHLALIE 803

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp99ANP_651691.4 FN3 140..236 CDD:238020
fn3 249..331 CDD:278470
FN3 342..437 CDD:238020
FN3 442..520 CDD:238020
PTPc 646..911 CDD:214550 109/282 (39%)
PTPc 676..911 CDD:238006 102/252 (40%)
PTPc 935..1186 CDD:214550
PTPc 963..1169 CDD:238006
Ptpmeg2NP_572576.1 CRAL_TRIO_N <114..144 CDD:215024
SEC14 170..314 CDD:238099
Y_phosphatase 557..803 CDD:278528 103/255 (40%)
PTPc 559..803 CDD:238006 102/253 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 163 1.000 Domainoid score I1235
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46470
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19134
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.