| Sequence 1: | NP_651691.4 | Gene: | Ptp99A / 43469 | FlyBaseID: | FBgn0004369 | Length: | 1397 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001099344.2 | Gene: | Mylk / 288057 | RGDID: | 1310915 | Length: | 1961 | Species: | Rattus norvegicus |
| Alignment Length: | 332 | Identity: | 73/332 - (21%) |
|---|---|---|---|
| Similarity: | 114/332 - (34%) | Gaps: | 112/332 - (33%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 50 AEAGKNVTIPCPGVNEH-------------SLVDTLVWKTASTTIAQFANRIP--------LLHS 93
Fly 94 PRIQLLS-----DNFG------------------LQFSPSLASDTSE-----------------Y 118
Fly 119 ICLV-NDRHIPEAIVDLLVQDVPDPPE-RPLLISFTSRSVNLSWAHSQHPRNAPVTHFIIETREG 181
Fly 182 EDGIWEQLARIYTKTNATSYQVTGLTPFTVYSFRLLAVNKLGISPPSKESYYIVTLREAPTGKPI 246
Fly 247 PTTAHNTSSTSVYISWKAPPPDTILGEFLGYRITYRPRDRDPNDTKEIYIRDNTVESHEIQNLQT 311
Fly 312 YTQYKVT 318 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Ptp99A | NP_651691.4 | FN3 | 140..236 | CDD:238020 | 35/96 (36%) |
| fn3 | 249..331 | CDD:278470 | 10/70 (14%) | ||
| FN3 | 342..437 | CDD:238020 | |||
| FN3 | 442..520 | CDD:238020 | |||
| PTPc | 646..911 | CDD:214550 | |||
| PTPc | 676..911 | CDD:238006 | |||
| PTPc | 935..1186 | CDD:214550 | |||
| PTPc | 963..1169 | CDD:238006 | |||
| Mylk | NP_001099344.2 | I-set | 42..132 | CDD:254352 | |
| Ig | 64..129 | CDD:143165 | |||
| I-set | 165..254 | CDD:254352 | |||
| Ig | 183..251 | CDD:143165 | |||
| 23ISL | 255..408 | CDD:293226 | |||
| I-set | 410..500 | CDD:254352 | |||
| Ig | 427..497 | CDD:143165 | |||
| I-set | 510..596 | CDD:254352 | |||
| IGc2 | 523..586 | CDD:197706 | |||
| I-set | 619..708 | CDD:254352 | |||
| Ig | 636..704 | CDD:143165 | |||
| I-set | 717..805 | CDD:254352 | |||
| Ig | 720..805 | CDD:299845 | |||
| I-set | 1141..1230 | CDD:254352 | 3/7 (43%) | ||
| IGc2 | 1154..1220 | CDD:197706 | |||
| Ig | 1281..1378 | CDD:299845 | 19/96 (20%) | ||
| I-set | 1281..1370 | CDD:254352 | 14/88 (16%) | ||
| FN3 | 1374..1465 | CDD:238020 | 35/129 (27%) | ||
| STKc_MLCK1 | 1504..1762 | CDD:271093 | 0/1 (0%) | ||
| Pkinase | 1507..1762 | CDD:278497 | |||
| I-set | 1852..1942 | CDD:254352 | |||
| IGc2 | 1865..1932 | CDD:197706 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG0613 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||