DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp99A and sre-45

DIOPT Version :9

Sequence 1:NP_651691.4 Gene:Ptp99A / 43469 FlyBaseID:FBgn0004369 Length:1397 Species:Drosophila melanogaster
Sequence 2:NP_496843.2 Gene:sre-45 / 186258 WormBaseID:WBGene00010071 Length:369 Species:Caenorhabditis elegans


Alignment Length:196 Identity:37/196 - (18%)
Similarity:69/196 - (35%) Gaps:59/196 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   857 VGRTGTYIVLDAM-----------LKQIQQKNIV--NVFGFLRHIRAQRNFLV------------ 896
            ||:|.|.:|:..:           ...|...||:  .:|.:::|:..|.|..:            
 Worm   176 VGQTSTNLVMGYLFFFNAAHFAVGFSIILSTNIIAMGIFTYVKHVNRQVNRAIEDFSNPSLYCLP 240

  Fly   897 ---QTEE-----QYI--FLHDALVEAIASGETNLMAEQVEELKNCTPYLEQQYKNIIQFQPKDIH 951
               |..|     |.|  .:|..|...:.:...||.. .:|......|.|...:::.|...|..| 
 Worm   241 ARFQVRENVRCFQMITKVIHAGLFLILTACFVNLFM-YLELTPGLDPLLNLIFESAINLNPVVI- 303

  Fly   952 IASAMKQVNSIKN---------------RGAIFPI-------EGSRVHLTPKPGEDGSDYINASW 994
            :.:.:..||:.:|               |..|..:       :|::...|.|..:...|.:|::|
 Worm   304 VPTLLGSVNAWRNFTFSSGVCLGFKAQVRLKIIKVSSVSIGNDGAKSDRTRKETDAYFDQLNSAW 368

  Fly   995 L 995
            :
 Worm   369 I 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp99ANP_651691.4 FN3 140..236 CDD:238020
fn3 249..331 CDD:278470
FN3 342..437 CDD:238020
FN3 442..520 CDD:238020
PTPc 646..911 CDD:214550 18/88 (20%)
PTPc 676..911 CDD:238006 18/88 (20%)
PTPc 935..1186 CDD:214550 15/83 (18%)
PTPc 963..1169 CDD:238006 9/55 (16%)
sre-45NP_496843.2 Sre 1..369 CDD:251743 36/194 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.