powered by:
Protein Alignment Ptp99A and F47B3.2
DIOPT Version :9
Sequence 1: | NP_651691.4 |
Gene: | Ptp99A / 43469 |
FlyBaseID: | FBgn0004369 |
Length: | 1397 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_491277.1 |
Gene: | F47B3.2 / 185885 |
WormBaseID: | WBGene00018526 |
Length: | 130 |
Species: | Caenorhabditis elegans |
Alignment Length: | 71 |
Identity: | 29/71 - (40%) |
Similarity: | 48/71 - (67%) |
Gaps: | 7/71 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 845 EAGPIVVHCSAGVGRTGTYI----VLDAMLKQIQQKNIVNVFGFLRHIRAQRNFLVQTEEQYIFL 905
:..|:||||||||||:||.: ::|.|::.|..|::..: :..||.||::.:|||.||:::
Worm 13 DTNPVVVHCSAGVGRSGTIVGISLIMDKMIQGINCKDMKKL---VEEIRNQRHYAIQTEAQYMYI 74
Fly 906 HDALVE 911
|..|:|
Worm 75 HRVLLE 80
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0789 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.