DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp99A and F20B6.6

DIOPT Version :10

Sequence 1:NP_651691.4 Gene:Ptp99A / 43469 FlyBaseID:FBgn0004369 Length:1397 Species:Drosophila melanogaster
Sequence 2:NP_001359997.1 Gene:F20B6.6 / 184714 WormBaseID:WBGene00017630 Length:95 Species:Caenorhabditis elegans


Alignment Length:70 Identity:13/70 - (18%)
Similarity:25/70 - (35%) Gaps:15/70 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   602 PPHHPNAPQVDWEVPVKI---------GDEIRAAVPVNE------FAKHVASLHADGDIGFSREY 651
            ||.:...|:...|...|:         |.|.:...|..:      ..|..:::........::||
 Worm    11 PPDNNGKPKPSHEKDAKVKKNDDDDDLGSEKKDLEPKEKEQRAEMIKKWASAVMMSTPQQLTKEY 75

  Fly   652 EAIQN 656
            :|:.|
 Worm    76 KAVGN 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp99ANP_651691.4 FN3 140..236 CDD:238020
FN3 243..337 CDD:238020
fn3 343..430 CDD:394996
FN3 442..520 CDD:238020
R5-PTPc-1 704..907 CDD:350397
R5-PTP-2 989..1182 CDD:350398
F20B6.6NP_001359997.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.