DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp99A and F20B6.6

DIOPT Version :9

Sequence 1:NP_651691.4 Gene:Ptp99A / 43469 FlyBaseID:FBgn0004369 Length:1397 Species:Drosophila melanogaster
Sequence 2:NP_001359997.1 Gene:F20B6.6 / 184714 WormBaseID:WBGene00017630 Length:95 Species:Caenorhabditis elegans


Alignment Length:70 Identity:13/70 - (18%)
Similarity:25/70 - (35%) Gaps:15/70 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   602 PPHHPNAPQVDWEVPVKI---------GDEIRAAVPVNE------FAKHVASLHADGDIGFSREY 651
            ||.:...|:...|...|:         |.|.:...|..:      ..|..:::........::||
 Worm    11 PPDNNGKPKPSHEKDAKVKKNDDDDDLGSEKKDLEPKEKEQRAEMIKKWASAVMMSTPQQLTKEY 75

  Fly   652 EAIQN 656
            :|:.|
 Worm    76 KAVGN 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp99ANP_651691.4 FN3 140..236 CDD:238020
fn3 249..331 CDD:278470
FN3 342..437 CDD:238020
FN3 442..520 CDD:238020
PTPc 646..911 CDD:214550 4/11 (36%)
PTPc 676..911 CDD:238006
PTPc 935..1186 CDD:214550
PTPc 963..1169 CDD:238006
F20B6.6NP_001359997.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.