DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp99A and Ptp69D

DIOPT Version :10

Sequence 1:NP_651691.4 Gene:Ptp99A / 43469 FlyBaseID:FBgn0004369 Length:1397 Species:Drosophila melanogaster
Sequence 2:XP_061508307.1 Gene:Ptp69D / 1273859 VectorBaseID:AGAMI1_008430 Length:1471 Species:Anopheles gambiae


Alignment Length:69 Identity:12/69 - (17%)
Similarity:30/69 - (43%) Gaps:27/69 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 MQYMYT-GQSSVPEYNVD-----------------------DVLRSGELLKIRGFWSESRSGG-- 252
            ::|.:| |:..|..:.:.                       :|::..:|::: |..::.::||  
Mosquito    32 LEYFFTSGEDEVKAWTIQVGTPAPKAAGRIHTDFEKGFIMAEVMKVADLIEL-GDEAKCKAGGKY 95

  Fly   253 QQQG 256
            :|||
Mosquito    96 RQQG 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp99ANP_651691.4 FN3 140..236 CDD:238020 5/45 (11%)
FN3 243..337 CDD:238020 6/16 (38%)
fn3 343..430 CDD:394996
FN3 442..520 CDD:238020
R5-PTPc-1 704..907 CDD:350397
R5-PTP-2 989..1182 CDD:350398
Ptp69DXP_061508307.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.