DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stg and YCH1

DIOPT Version :9

Sequence 1:NP_001263066.1 Gene:stg / 43466 FlyBaseID:FBgn0003525 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_011719.1 Gene:YCH1 / 853117 SGDID:S000003435 Length:148 Species:Saccharomyces cerevisiae


Alignment Length:106 Identity:28/106 - (26%)
Similarity:50/106 - (47%) Gaps:12/106 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   320 YRIIDCRYPYEFEGGHI-EGAKNLYTTEQILDEFLTVQQTELQQQQNAESGHKRNIIIFHCEFSS 383
            ::::|.| ..::.|||| :|....|:..:...|:|...:..|.::|  ..|.....:||||..|.
Yeast    33 FQVVDVR-GSDYMGGHIKDGWHYAYSRLKQDPEYLRELKHRLLEKQ--ADGRGALNVIFHCMLSQ 94

  Fly   384 ERGPKMSR-FLRNLDRERNTNAYPALHYPEIYLLHNGYKEF 423
            :|||..:. .||:||...       |....:::|..|:..:
Yeast    95 QRGPSAAMLLLRSLDTAE-------LSRCRLWVLRGGFSRW 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stgNP_001263066.1 Cdc25 297..425 CDD:238788 28/106 (26%)
YCH1NP_011719.1 Acr2p 9..132 CDD:238789 28/106 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.