DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stg and ibp1

DIOPT Version :9

Sequence 1:NP_001263066.1 Gene:stg / 43466 FlyBaseID:FBgn0003525 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_595247.1 Gene:ibp1 / 2541214 PomBaseID:SPBC839.07 Length:138 Species:Schizosaccharomyces pombe


Alignment Length:122 Identity:36/122 - (29%)
Similarity:54/122 - (44%) Gaps:22/122 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   309 LKGEFSDKVASYRIIDCRYPYEFEGGHIEGAKNLYTTEQILDEFLTVQQTELQQQQNAESGHKRN 373
            |||...:......|||.| .|::||..|.|:..:.:     |.||.      ...|:.:...|:.
pombe    12 LKGWLMESPNEISIIDVR-DYDYEGERIPGSVRIPS-----DTFLA------SVDQHVDDLMKKR 64

  Fly   374 IIIFHCEFSSERGPKMSRFLRNLDRERNTNAYPAL----------HYPEIYLLHNGY 420
            .:|.||.:|..||||.:|.|..:.|.|.|.:...|          :.|.:|:||.|:
pombe    65 SLIVHCTYSQVRGPKAARVLSEILRNRITESKEKLSLSQKEKLFQNLPTVYILHGGF 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stgNP_001263066.1 Cdc25 297..425 CDD:238788 36/122 (30%)
ibp1NP_595247.1 Acr2p 4..128 CDD:238789 36/122 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R583
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.