DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stg and cdc-25.3

DIOPT Version :9

Sequence 1:NP_001263066.1 Gene:stg / 43466 FlyBaseID:FBgn0003525 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_498972.1 Gene:cdc-25.3 / 176260 WormBaseID:WBGene00000388 Length:316 Species:Caenorhabditis elegans


Alignment Length:286 Identity:91/286 - (31%)
Similarity:134/286 - (46%) Gaps:68/286 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 SANCSPIQSKRHRCAAVEKENCPAPSPLSQVTISHPPPLRKCM---------SLNDAEI-----M 263
            |:...|.|:::|            .|.:|.::.|.||..::.:         |.|.:||     :
 Worm    28 SSKLFPRQNRQH------------SSAISHISNSSPPTRKRSIDGGYTSGTDSANTSEIVIKKRL 80

  Fly   264 SALARSENRNEPE-----LIGDFSKAYALPLMEGRHRDLKSISSETVARLLKG----EFSDKVAS 319
            :...:|.:.:|.|     |..|:......|.....:   :.|:|||:..:::.    ||..|   
 Worm    81 TFSKKSHSTSEIETWNAHLQVDYHLETVTPSCSTVY---QKITSETLIEIMQKLSQIEFMQK--- 139

  Fly   320 YRIIDCRYPYEFEGGHIEGAKNLYTTEQILDEFLTVQQTELQQQQNAESGHKRN-IIIFHCEFSS 383
            |.:|||||.||:.||||:||::|:..|...|.|.           |.:...|.| |.||:||:|.
 Worm   140 YILIDCRYDYEYNGGHIKGAQSLFNPETAADFFF-----------NKDGSKKINRIPIFYCEYSQ 193

  Fly   384 ERGPKMSRFLRNLDRERNTNAYPALHYPEIYLLHNGYKEFF--------ESHVELCEPHAYRTML 440
            :|||.|:..||.:||:.|:|.||...|.|||||..|||.|:        |..|:||||..|..|.
 Worm   194 KRGPTMANNLREVDRKLNSNIYPRCDYEEIYLLEGGYKNFYAFTRGLEKEQRVQLCEPDNYVIMF 258

  Fly   441 DPAYN-EAYRH-FRAKS-----KSWN 459
            |..|. |..:| |..|:     |.|:
 Worm   259 DDRYKAELRKHQFHKKNVSKPMKKWS 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stgNP_001263066.1 Cdc25 297..425 CDD:238788 56/140 (40%)
cdc-25.3NP_498972.1 Cdc25 116..235 CDD:238788 56/135 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160156
Domainoid 1 1.000 96 1.000 Domainoid score I4595
eggNOG 1 0.900 - - E1_COG5105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1423329at2759
OrthoFinder 1 1.000 - - FOG0000931
OrthoInspector 1 1.000 - - mtm4793
orthoMCL 1 0.900 - - OOG6_101194
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R583
SonicParanoid 1 1.000 - - X695
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.680

Return to query results.
Submit another query.