DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stg and XB5832479

DIOPT Version :9

Sequence 1:NP_001263066.1 Gene:stg / 43466 FlyBaseID:FBgn0003525 Length:479 Species:Drosophila melanogaster
Sequence 2:XP_012823230.1 Gene:XB5832479 / 100497395 XenbaseID:XB-GENE-5832480 Length:413 Species:Xenopus tropicalis


Alignment Length:350 Identity:126/350 - (36%)
Similarity:167/350 - (47%) Gaps:78/350 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 SMR------RPSVRRCLSMTESNTNSTTTPP---PK---------------TPETARDCFKRPEP 210
            |||      |.|.||.|.::..:.|.:.|.|   |:               ||....|..|..:.
 Frog    51 SMRLLNCEHRISPRRRLKLSPDSQNPSPTEPNNQPQASMETKHFAGLLNLSTPRPDTDIIKSSDS 115

  Fly   211 PASANCSPIQSKRHRCAAVEKENCPAP--SPLSQVTIS---------HPPPLRKCMSLNDAEIMS 264
            .......|.::.|........||...|  ...|::.:|         :..|.::|    :...:.
 Frog   116 SYGPKIQPKKTTRRVQMRQHDENAAQPGIQKKSRMKLSDLFDSMEHINEQPRQQC----EKAKVK 176

  Fly   265 ALARSEN-----RNEPE----------------------LIGDFSKAYALPLMEGRHRDLKSISS 302
            .||:..|     :..||                      |||||||||.|||..|:|::||.||.
 Frog   177 QLAKGGNNKRYGKKGPENKRPFVNGISPQFHAAQTEDDHLIGDFSKAYCLPLERGKHQELKYISC 241

  Fly   303 ETVARLLKGEFSDKVASYRIIDCRYPYEFEGGHIEGAKNLYTTEQILDEFLTVQQTELQQQQNAE 367
            .|:||||:|.:.|.|..|:|:|||||||:.||||:||.|||..|.|.|.||          :||.
 Frog   242 TTLARLLRGGYQDVVQQYQIVDCRYPYEYAGGHIKGAYNLYKEEHISDTFL----------KNAT 296

  Fly   368 SGHKRNIIIFHCEFSSERGPKMSRFLRNLDRERNTNAYPALHYPEIYLLHNGYKEFFESHVELCE 432
            ......::||||||||||.||:.|.|||||  ||.|.||.|||||:|:|..|||||:|.....||
 Frog   297 HPKSTTLLIFHCEFSSERAPKLCRLLRNLD--RNANRYPHLHYPELYILKGGYKEFYEKFKGFCE 359

  Fly   433 PHAYRTMLDPAYNEAYRHFRAKSKS 457
            |..|..||...:::..|.:..|:|:
 Frog   360 PRGYVNMLHKDFSDQLRQYHRKNKT 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stgNP_001263066.1 Cdc25 297..425 CDD:238788 72/127 (57%)
XB5832479XP_012823230.1 MIH1 <70..366 CDD:227436 113/311 (36%)
Cdc25 236..352 CDD:238788 72/127 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 124 1.000 Domainoid score I5443
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1423329at2759
OrthoFinder 1 1.000 - - FOG0000931
OrthoInspector 1 1.000 - - otm48936
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X695
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.