DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11951 and Rnpep

DIOPT Version :9

Sequence 1:NP_001350853.2 Gene:CG11951 / 43463 FlyBaseID:FBgn0039656 Length:924 Species:Drosophila melanogaster
Sequence 2:NP_112359.2 Gene:Rnpep / 81761 RGDID:621137 Length:650 Species:Rattus norvegicus


Alignment Length:371 Identity:93/371 - (25%)
Similarity:154/371 - (41%) Gaps:84/371 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 TQFEPAAARLAFPCFDEPGYKASFAITLGYHKKYTGLSNMPVNETR-PHESIPDYVWTSFEESLP 223
            ||.:....|..|||||.|..|.:::..:.....:|.:.:....|.| |::..       |:.:.|
  Rat   168 TQGQAVLNRAFFPCFDTPAVKCTYSALVEVPDGFTAVMSASTWERRGPNKFF-------FQMNQP 225

  Fly   224 MSTYLVAYSLNDFSHKPSTLPNGTLFRTWARPNAIDQC---------DYAAE----LGPKVLKYY 275
            :.:||:|.::.|.    ::...|...|.||.|..|:..         ::.|.    .||.|...|
  Rat   226 IPSYLIALAIGDL----ASAEVGPRSRVWAEPCLIEAAKEEYNGVIEEFLATGEKLFGPYVWGRY 286

  Fly   276 EELFGIKFPLPKVDQIAVPDFSAGAMENWGLVTFAESTLLYSPEYSSQEAKQETANIVAHELAHQ 340
            :.||     :|       |.|..|.||| ..:||....||        ...:..|:::.||::|.
  Rat   287 DLLF-----MP-------PSFPFGGMEN-PCLTFVTPCLL--------AGDRSLADVIIHEISHS 330

  Fly   341 WFGNLVTMKWWTDLWLNEGFATY-----------VASLCVEDIHPQWRTLQLESMSNLLTIFRKD 394
            |||||||...|.:.||||||..|           .|..|:|  ....|.|..:.|         |
  Rat   331 WFGNLVTNANWGEFWLNEGFTMYAQRRISTILFGAAYTCLE--AATGRALLRQHM---------D 384

  Fly   395 SLESSHPISR---PIEMTSQISESFDEISYQKGSSVIR-MMHLFLGEEAFRTGLKSYLEKYTYKN 455
            .....:|:::   .||......::::|..|:||...:. :.||...:|.|...||:|::::.:::
  Rat   385 VSGEENPLNKLRVKIEPGVDPDDTYNETPYEKGYCFVSYLAHLVGDQEQFDKFLKAYVDEFKFQS 449

  Fly   456 AEQDNLWESLTQ---AAHKTG--SLPK-DYNIKTIMDSWTLQTGYP 495
            ...::..|...:   ...|.|  |:|. ::|      .|....|:|
  Rat   450 ILAEDFLEFYLEYFPELKKKGVDSIPGFEFN------RWLNTPGWP 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11951NP_001350853.2 M1_APN-Q_like 35..490 CDD:341064 91/364 (25%)
ERAP1_C 574..902 CDD:338125
RnpepNP_112359.2 M1_LTA4H 24..484 CDD:341062 91/364 (25%)
Substrate binding. /evidence=ECO:0000250 298..302 2/3 (67%)
Leuk-A4-hydro_C 530..645 CDD:401171
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.