DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11951 and RNPEP

DIOPT Version :9

Sequence 1:NP_001350853.2 Gene:CG11951 / 43463 FlyBaseID:FBgn0039656 Length:924 Species:Drosophila melanogaster
Sequence 2:NP_064601.3 Gene:RNPEP / 6051 HGNCID:10078 Length:650 Species:Homo sapiens


Alignment Length:369 Identity:91/369 - (24%)
Similarity:147/369 - (39%) Gaps:80/369 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 TQFEPAAARLAFPCFDEPGYKASFAITLGYHKKYTGLSNMPVNETR-PHESIPDYVWTSFEESLP 223
            ||.:....|..|||||.|..|..::..:.....:|.:.:....|.| |::..       |:...|
Human   168 TQGQAVLNRAFFPCFDTPAVKYKYSALIEVPDGFTAVMSASTWEKRGPNKFF-------FQMCQP 225

  Fly   224 MSTYLVAYSLNDFSHKPSTLPNGTLFRTWARPNAIDQC---------DYAAE----LGPKVLKYY 275
            :.:||:|.::.|.    .:...|...|.||.|..||..         ::.|.    .||.|...|
Human   226 IPSYLIALAIGDL----VSAEVGPRSRVWAEPCLIDAAKEEYNGVIEEFLATGEKLFGPYVWGRY 286

  Fly   276 EELFGIKFPLPKVDQIAVPDFSAGAMENWGLVTFAESTLLYSPEYSSQEAKQETANIVAHELAHQ 340
            :.||     :|       |.|..|.||| ..:||....||        ...:..|:::.||::|.
Human   287 DLLF-----MP-------PSFPFGGMEN-PCLTFVTPCLL--------AGDRSLADVIIHEISHS 330

  Fly   341 WFGNLVTMKWWTDLWLNEGFATY-----------VASLCVEDIHPQWRTLQLESMSNLLTIFRKD 394
            |||||||...|.:.||||||..|           .|..|:|  ....|.|..:.|         |
Human   331 WFGNLVTNANWGEFWLNEGFTMYAQRRISTILFGAAYTCLE--AATGRALLRQHM---------D 384

  Fly   395 SLESSHPISR---PIEMTSQISESFDEISYQKGSSVIR-MMHLFLGEEAFRTGLKSYLEKYTYKN 455
            .....:|:::   .||......::::|..|:||...:. :.||...::.|.:.||:|:.::.:::
Human   385 ITGEENPLNKLRVKIEPGVDPDDTYNETPYEKGFCFVSYLAHLVGDQDQFDSFLKAYVHEFKFRS 449

  Fly   456 AEQDNL----WESLTQAAHKTGSLPKDYNIKTIMDSWTLQTGYP 495
            ...|:.    .|...:...|...:...:.    .|.|....|:|
Human   450 ILADDFLDFYLEYFPELKKKRVDIIPGFE----FDRWLNTPGWP 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11951NP_001350853.2 M1_APN-Q_like 35..490 CDD:341064 89/362 (25%)
ERAP1_C 574..902 CDD:338125
RNPEPNP_064601.3 leuko_A4_hydro 24..634 CDD:274120 91/369 (25%)
M1_LTA4H 24..484 CDD:189006 89/362 (25%)
Substrate binding. /evidence=ECO:0000250 298..302 2/3 (67%)
Leuk-A4-hydro_C 504..644 CDD:286244
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.