DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11951 and CG10602

DIOPT Version :9

Sequence 1:NP_001350853.2 Gene:CG11951 / 43463 FlyBaseID:FBgn0039656 Length:924 Species:Drosophila melanogaster
Sequence 2:NP_609916.5 Gene:CG10602 / 35146 FlyBaseID:FBgn0032721 Length:684 Species:Drosophila melanogaster


Alignment Length:600 Identity:150/600 - (25%)
Similarity:230/600 - (38%) Gaps:168/600 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 PQSYDVRILTQLENPD-----DFHFNGTVKIQIEVLQ-------NTHNITLHSKDLTIDDTEITL 85
            |.||....|...|:..     ||   ...|||..||.       |...|.|..:|:.:  |..||
  Fly    80 PSSYSQPDLITTEHSALNWKIDF---AATKIQGSVLHRFKVLTANLDKILLDVRDINV--TNATL 139

  Fly    86 SQIGGEETTENCITSTAVNPTHDFYILNTCKELLAGQFYELSLPF-SAKLQDQLAGYYRSSYVNT 149
             ..||.|...|...|.||:.              .||...|.||. :||....:...|.:|   :
  Fly   140 -LAGGSELPINFFISDAVDD--------------IGQKLTLELPSGTAKGSLNVRIDYETS---S 186

  Fly   150 VANETRWISVT------------QFEPAAARLAFPCFDEPGYKASFAITLGYHKKYTGLSNMPVN 202
            .|:..:|::.|            |.:...||...||.|.|..|.::..|:.:..:.|.|.:..::
  Fly   187 SASGLQWLNPTQTLGKEHPYMFSQCQAIHARSVIPCQDTPAVKFTYDATVEHPSELTALMSALID 251

  Fly   203 ETRPHESIPDYVWTSFEESLPMSTYLVAYSLNDFSHKPSTLPNGTLFRTWARPNAIDQC------ 261
            :..|.:       |.|::.:|:..||||.::.    |..:.|.|.....||....:|.|      
  Fly   252 KKEPGK-------TLFKQEVPIPAYLVAIAIG----KLVSRPLGENSSVWAEEAIVDACAEEFSE 305

  Fly   262 -----DYAAEL-GPKVLKYYEELFGIKFPLPKVDQIAVPDFSAGAMENWGLVTFAESTLLYSPEY 320
                 ..|.|| ||.|.|.|:.|            :..|.|..|.||| ..:||...|||     
  Fly   306 TATMLKTATELCGPYVWKQYDLL------------VMPPSFPFGGMEN-PCLTFVTPTLL----- 352

  Fly   321 SSQEAKQETANIVAHELAHQWFGNLVTMKWWTDLWLNEGFATYVASLCVEDIHPQWRTLQLESMS 385
               ...:..|::||||:||.|.|||||.|.:...||||||..:|.|..|..:... :.|..:.:|
  Fly   353 ---AGDKSLADVVAHEIAHSWTGNLVTNKNFEHFWLNEGFTVFVESKIVGRMQGA-KELDFKMLS 413

  Fly   386 NLLTIFRKDSLESSHPISRPIEMTSQI--------SESFDEISYQKGSSVIRMMH-LFLGEEAFR 441
            ||..:  ::.:.:.  :::..|:|..:        .::|..:.|.|||:.:|.:. ||.|...|.
  Fly   414 NLTDL--QECIRTQ--LNKTPELTKLVVDLSNCGPDDAFSSVPYIKGSTFLRYLEDLFGGPTVFE 474

  Fly   442 TGLKSYLEKYTYKNAEQD------------------------NLW--------------ESLTQA 468
            ..|:.||:||.||:.|..                        :||              |||...
  Fly   475 PFLRDYLKKYAYKSIETKDFQSALYDYFIDTDKKDKLSAVDWDLWLKSEGMPPVIPNFDESLANV 539

  Fly   469 AHKTGSLPKDYNIKTIMDSWTLQTGYPV-----------------------INVTRD-YTSRTAK 509
            ..:..||....::..:.||..::|...:                       ||:... |..:::|
  Fly   540 TKELASLWSSKSVAELADSAEIKTTISIHQLIDFLGKLIESKDIVDLNEGKINLLESTYNLKSSK 604

  Fly   510 LSQERYLLNTDVSRA 524
            .::.|:.||..:.||
  Fly   605 NAEVRFRLNRLIIRA 619

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11951NP_001350853.2 M1_APN-Q_like 35..490 CDD:341064 139/538 (26%)
ERAP1_C 574..902 CDD:338125
CG10602NP_609916.5 Ribosomal_L13 16..>50 CDD:294238
leuko_A4_hydro 79..681 CDD:274120 149/599 (25%)
M1_LTA4H 79..520 CDD:189006 132/499 (26%)
Leuk-A4-hydro_C 541..680 CDD:286244 13/78 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.