DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp1 and Usp12

DIOPT Version :9

Sequence 1:NP_001263061.1 Gene:Usp1 / 43462 FlyBaseID:FBgn0028476 Length:1078 Species:Drosophila melanogaster
Sequence 2:NP_001160048.1 Gene:Usp12 / 360763 RGDID:1308045 Length:370 Species:Rattus norvegicus


Alignment Length:562 Identity:101/562 - (17%)
Similarity:155/562 - (27%) Gaps:274/562 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 GSSSNEIE-----SQEPQSHQYYGPNGGSNAAGAGAGLNGSAAALNHAPSMGTLCNIGNSCYLNS 328
            |::::.:|     .|.|.:..|:|                             |.|.||:||.||
  Rat    17 GANASALEKEIGPEQFPVNEHYFG-----------------------------LVNFGNTCYCNS 52

  Fly   329 VVYTLRFAPHFLHNLHHLIQDLNVVQQTIVRQQTARSASLGKNVSAAQLEHARSWSSKDLATSTD 393
            |:..|.|                                            .|.:..|.||    
  Rat    53 VLQALYF--------------------------------------------CRPFRDKVLA---- 69

  Fly   394 QYSGQNGGVNSGNGGSGSSKSTHQSVTEKLHELYNNLHGNEMADSTEPYHADTLLHAIQDVNATF 458
             |..|              ....:|:...|.:|::::...:......|  ....:..::..|..|
  Rat    70 -YKSQ--------------PRKKESLLTCLADLFHSIATQKKKVGVIP--PKKFITRLRKENELF 117

  Fly   459 EGNQQQDAHEFLMCVLNCIRETNQSLIKAIGECPEVIANGYIANPDEVDTGEGQDRTDSTASQNL 523
            :...||||||||..:||.|.:..|                                         
  Rat   118 DNYMQQDAHEFLNYLLNTIADILQ----------------------------------------- 141

  Fly   524 NAGNGSLATSQTTTTKTSFFSRKSKRKDEVKPSKSTRVQSPLKENSPTAGGITGAGTAHATANSL 588
                                   .:||.|             |:|.....|              
  Rat   142 -----------------------EERKQE-------------KQNGRLRNG-------------- 156

  Fly   589 FYLNTVDLSGASSTSGSASTSASGVVSTSAALPTPPQATKYSSDDEMNSATVLKDKMRLEERIRE 653
                .||....:||                  |.|..                         :.|
  Rat   157 ----DVDSEDNNST------------------PDPTW-------------------------VHE 174

  Fly   654 LNLNFFSSDFEGIVVLTTKCLSCETITRQKQGMLDISVPVPISGYDNADLQDKPSTYIQNSCIT- 717
            :        |:|.:...|:||:||||:.:.:..||:||.|.                 ||:.|| 
  Rat   175 I--------FQGTLTNETRCLTCETISSKDEDFLDLSVDVE-----------------QNTSITH 214

  Fly   718 -------KEYFRGENKYSCNQCTGYTEAIRSISYEVLPRLLVIQLNRFSGGMEKVSTYVPTTF-- 773
                   .|....|.||.|.:|....||.:.:..:.||.:|.:.|.||. .|:::..|...::  
  Rat   215 CLRGFSNTETLCSEYKYYCEECRSKQEAHKRMKVKKLPMILALHLKRFK-YMDQLHRYTKLSYRV 278

  Fly   774 TLPCFCATCCELGEG-NKLHVYKLYSVITHVGATLTVGHYIA 814
            ..|.........|:. |...:|.|.:|:.|.|:....|||||
  Rat   279 VFPLELRLFNTSGDATNPDRMYDLVAVVVHCGSGPNRGHYIA 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp1NP_001263061.1 Peptidase_C19 308..819 CDD:271592 95/518 (18%)
Usp12NP_001160048.1 Peptidase_C19G 40..367 CDD:239128 96/539 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1864
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.