DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp1 and Usp14

DIOPT Version :9

Sequence 1:NP_001263061.1 Gene:Usp1 / 43462 FlyBaseID:FBgn0028476 Length:1078 Species:Drosophila melanogaster
Sequence 2:NP_001260321.1 Gene:Usp14 / 34387 FlyBaseID:FBgn0032216 Length:475 Species:Drosophila melanogaster


Alignment Length:514 Identity:90/514 - (17%)
Similarity:151/514 - (29%) Gaps:208/514 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   317 LCNIGNSCYLNSVVYTLRFAPHFLHNLHHLIQDLNVVQQTIVRQQTARSASLGKNVSAAQLEHAR 381
            |.|:||:||:|:.|..|...|                                            
  Fly   106 LTNLGNTCYMNATVQCLNAVP-------------------------------------------- 126

  Fly   382 SWSSKDLATSTDQYSGQNGGVNSGNGGSGSSKSTHQSVTEKLHELYNNLHGNEMADSTEPYHADT 446
                 :|.|:...:|         |.|: .:.||..|::..:..::..:   |...:..|.   .
  Fly   127 -----ELRTALSTFS---------NDGT-DTMSTAFSISSAMKSIFAQM---EKGTTVTPI---V 170

  Fly   447 LLHAIQDVNATFEGN------QQQDAH----EFLMCVLNCIRETNQSLIKAIGECPEVIANGYIA 501
            ||.|:...:..|...      :||||:    |.|..:...:|..||.....:.:......:.:..
  Fly   171 LLQALHRASPQFAQTGENGTYRQQDANECWAEILKMLQQKLRPKNQEPSNTVQKRHSSFIDQFFG 235

  Fly   502 NPDEVDTGEGQDRTDSTASQNLNAGNGSLATSQTTTTKTSFFSRKSKRKDEVKPSKS---TRVQS 563
            ...||.....:|..:.           |..||:.....:.|.|.      :||..:|   ::::.
  Fly   236 GTFEVKMSSEEDPDEP-----------STVTSENFLQLSCFISM------DVKYMQSGLKSKMKE 283

  Fly   564 PLKENSPTAGGITGAGTAHATANSLFYLNTVDLSGASSTSGSASTSASGVVSTSAALPTPPQATK 628
            .|.:.|.|.|            ....|:.|..:|                 ...|.|.......:
  Fly   284 QLVKKSETLG------------RDAKYIRTYLVS-----------------RLPAYLTVQFVRFQ 319

  Fly   629 YSSDDEMNSATVLKDKMRLEERIRELNLNFFSSDFEGIVVLTTKCLS--CETITRQKQGMLDISV 691
            |...:.:| |.||||       |:      |..||:...:.|.:..:  |...::.|        
  Fly   320 YKGKEGIN-AKVLKD-------IK------FPIDFDAFELCTPELQNKLCPMRSKFK-------- 362

  Fly   692 PVPISGYDNADLQDKPSTYIQNSCITKEYFRGENKYSCNQCTGYTEAIRSISYEVLPRLLVIQLN 756
                      ||:||.    ....:.|.....|.|             :.:.||..         
  Fly   363 ----------DLEDKK----MEVDVVKRNEPNEEK-------------KDVKYEQF--------- 391

  Fly   757 RFSGGMEKVSTYVPTTFTLPCFCATCCELGEGNKLHVYKLYSVITHVGATLTVGHYIAY 815
            .|..                       :||..|..: |.|.:|:||.|.:.:.|||:|:
  Fly   392 WFDD-----------------------DLGSNNSGY-YTLQAVLTHKGRSSSSGHYVAW 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp1NP_001263061.1 Peptidase_C19 308..819 CDD:271592 90/514 (18%)
Usp14NP_001260321.1 UBQ 4..73 CDD:214563
UBQ 5..73 CDD:294102
UCH 103..467 CDD:278850 90/514 (18%)
Peptidase_C19A 105..467 CDD:239122 90/514 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456838
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.