DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14507 and PLA2G10

DIOPT Version :9

Sequence 1:NP_001097964.1 Gene:CG14507 / 43461 FlyBaseID:FBgn0039655 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_003552.1 Gene:PLA2G10 / 8399 HGNCID:9029 Length:165 Species:Homo sapiens


Alignment Length:128 Identity:44/128 - (34%)
Similarity:56/128 - (43%) Gaps:25/128 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 LLPEGDRG---------KRDVARLYSMIKCSTGCDPLIYKGYGCYCGFGGHGVPADGIDRCCRVH 288
            |||....|         :|.:..|...:.|.....|:.|..|||:||.||||.|.|.||.||..|
Human    24 LLPGPGSGEASRILRVHRRGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQPRDAIDWCCHGH 88

  Fly   289 DKCY---GQSNCISYLEYFVPYVWKCYRGKPLCAVDHGEFGGP--DSCAARLCQCDLRLSRCL 346
            |.||   .::.|....|   .|.|:|.....||        ||  :.|...||:||..::.||
Human    89 DCCYTRAEEAGCSPKTE---RYSWQCVNQSVLC--------GPAENKCQELLCKCDQEIANCL 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14507NP_001097964.1 PLA2c 243..357 CDD:153091 39/109 (36%)
PLA2G10NP_003552.1 PLA2c 43..157 CDD:153091 39/109 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 76 1.000 Domainoid score I8954
eggNOG 1 0.900 - - E1_KOG4087
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1422829at2759
OrthoFinder 1 1.000 - - FOG0000342
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101872
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3674
SonicParanoid 1 1.000 - - X246
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.710

Return to query results.
Submit another query.