DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14507 and PLA2-DELTA

DIOPT Version :9

Sequence 1:NP_001097964.1 Gene:CG14507 / 43461 FlyBaseID:FBgn0039655 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_001328472.1 Gene:PLA2-DELTA / 829068 AraportID:AT4G29470 Length:191 Species:Arabidopsis thaliana


Alignment Length:58 Identity:22/58 - (37%)
Similarity:27/58 - (46%) Gaps:12/58 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 VARLYSMIKCSTGCDPLIYK------GYGCYCGFGGHGV----PADGIDRCCRVHDKC 291
            :|.::|..|||..|  :..|      .||.|||.|..|.    |.|.:|.||..||.|
plant    20 LAVVHSQEKCSKTC--IAQKCNVLGIRYGKYCGIGYFGCPGEPPCDDLDDCCMTHDNC 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14507NP_001097964.1 PLA2c 243..357 CDD:153091 22/58 (38%)
PLA2-DELTANP_001328472.1 PLA2_like 27..139 CDD:414410 20/51 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1422829at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11716
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.