powered by:
Protein Alignment CG14507 and PLA2-DELTA
DIOPT Version :9
Sequence 1: | NP_001097964.1 |
Gene: | CG14507 / 43461 |
FlyBaseID: | FBgn0039655 |
Length: | 373 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001328472.1 |
Gene: | PLA2-DELTA / 829068 |
AraportID: | AT4G29470 |
Length: | 191 |
Species: | Arabidopsis thaliana |
Alignment Length: | 58 |
Identity: | 22/58 - (37%) |
Similarity: | 27/58 - (46%) |
Gaps: | 12/58 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 244 VARLYSMIKCSTGCDPLIYK------GYGCYCGFGGHGV----PADGIDRCCRVHDKC 291
:|.::|..|||..| :..| .||.|||.|..|. |.|.:|.||..||.|
plant 20 LAVVHSQEKCSKTC--IAQKCNVLGIRYGKYCGIGYFGCPGEPPCDDLDDCCMTHDNC 75
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG14507 | NP_001097964.1 |
PLA2c |
243..357 |
CDD:153091 |
22/58 (38%) |
PLA2-DELTA | NP_001328472.1 |
PLA2_like |
27..139 |
CDD:414410 |
20/51 (39%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1422829at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR11716 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.110 |
|
Return to query results.
Submit another query.