DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14507 and PLA2-DELTA

DIOPT Version :10

Sequence 1:NP_001097964.1 Gene:CG14507 / 43461 FlyBaseID:FBgn0039655 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_194676.2 Gene:PLA2-DELTA / 829068 AraportID:AT4G29470 Length:191 Species:Arabidopsis thaliana


Alignment Length:58 Identity:22/58 - (37%)
Similarity:27/58 - (46%) Gaps:12/58 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 VARLYSMIKCSTGCDPLIYK------GYGCYCGFGGHGV----PADGIDRCCRVHDKC 291
            :|.::|..|||..|  :..|      .||.|||.|..|.    |.|.:|.||..||.|
plant    20 LAVVHSQEKCSKTC--IAQKCNVLGIRYGKYCGIGYFGCPGEPPCDDLDDCCMTHDNC 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14507NP_001097964.1 PLA2c 243..357 CDD:153091 22/58 (38%)
PLA2-DELTANP_194676.2 PLA2_like 27..139 CDD:471240 20/51 (39%)

Return to query results.
Submit another query.