powered by:
Protein Alignment CG14507 and PLA2-ALPHA
DIOPT Version :9
Sequence 1: | NP_001097964.1 |
Gene: | CG14507 / 43461 |
FlyBaseID: | FBgn0039655 |
Length: | 373 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001324649.1 |
Gene: | PLA2-ALPHA / 815261 |
AraportID: | AT2G06925 |
Length: | 148 |
Species: | Arabidopsis thaliana |
Alignment Length: | 56 |
Identity: | 20/56 - (35%) |
Similarity: | 24/56 - (42%) |
Gaps: | 13/56 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 252 KCSTGCD-------PLIYKGYGCYCGFGGHGV----PADGIDRCCRVHDKCYGQSN 296
:||..|: |.: .||.|||....|. |.||:|.||..||.|....|
plant 37 ECSRKCESEFCSVPPFL--RYGKYCGLLYSGCPGERPCDGLDSCCMKHDACVQSKN 90
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1422829at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR11716 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X246 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 3.110 |
|
Return to query results.
Submit another query.