DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14507 and OC90

DIOPT Version :9

Sequence 1:NP_001097964.1 Gene:CG14507 / 43461 FlyBaseID:FBgn0039655 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_001073868.2 Gene:OC90 / 729330 HGNCID:8100 Length:477 Species:Homo sapiens


Alignment Length:308 Identity:80/308 - (25%)
Similarity:116/308 - (37%) Gaps:97/308 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 NISQSATAIDSPSTI--PPETSVK---TSLM--VSPQQDWQQMGLDGWTGELKPPVASLEQDH-- 150
            :::.|...:|:...:  .|||::|   |:|:  |.|.:. ....|...:||        |..|  
Human   177 SLNSSLNLLDTSFCLAQTPETTIKEDLTTLLPRVVPVEP-TDTSLTALSGE--------EAGHDQ 232

  Fly   151 ------RDTRPPISWQNSYPHDEIRLEFQNHHFDGRVTDIRVITQTTSK-----PAEMEDL-MNV 203
                  |.|.||.|       .||                 |.|:.|:|     ||.::.| :.|
Human   233 EGVGAARATSPPGS-------AEI-----------------VATRVTAKIVTLVPAGIKSLGLAV 273

  Fly   204 QNVYIARVNDPFGYSMKWSFTNDSSREKEL-------LPEGDRGKRDVARLYSMIKCSTGCDPLI 261
            .:|    .|||           :.:.||..       |..|| ..:.:.:|..|:.|.|...|..
Human   274 SSV----ENDP-----------EETTEKACDRFTFLHLGSGD-NMQVMPQLGEMLFCLTSRCPEE 322

  Fly   262 YKGYGCYCGFGGHGVPADGIDRCCRVHDKCYGQSNCISYLEYFVPYVWKCYRGKPLCAVDH-GEF 325
            ::.||||||..|.|.|.|.:||||..|..|..|...:..|...:|:       .|:..||| .:.
Human   323 FESYGCYCGQEGRGEPRDDLDRCCLSHHCCLEQVRRLGCLLERLPW-------SPVVCVDHTPKC 380

  Fly   326 GGPDSCAARLCQCDLRLSRCL------------KRYYCPHRRSICHSS 361
            ||...|...||.||...:.|:            .|..||.:.:.|..|
Human   381 GGQSLCEKLLCACDQTAAECMTSASFNQSLKSPSRLGCPGQPAACEDS 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14507NP_001097964.1 PLA2c 243..357 CDD:153091 39/126 (31%)
OC90NP_001073868.2 Phospholipase A2-like 1 76..190 2/12 (17%)
otoconin_90 78..195 CDD:153096 2/17 (12%)
Phospholipase A2-like 2 305..361 22/55 (40%)
otoconin_90 307..423 CDD:153096 39/122 (32%)
Phospholipase A2-like 3 373..425 14/51 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 428..477 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 76 1.000 Domainoid score I8954
eggNOG 1 0.900 - - E1_KOG4087
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1422829at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.