DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14507 and PLA2G2A

DIOPT Version :9

Sequence 1:NP_001097964.1 Gene:CG14507 / 43461 FlyBaseID:FBgn0039655 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_000291.1 Gene:PLA2G2A / 5320 HGNCID:9031 Length:144 Species:Homo sapiens


Alignment Length:133 Identity:43/133 - (32%)
Similarity:57/133 - (42%) Gaps:21/133 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 DVARLYSMIKCSTGCD-PLIYKGYGCYCGFGGHGVPADGIDRCCRVHDKCYGQSNCISYLEYFVP 306
            ::...:.|||.:||.: .|.|..|||:||.||.|.|.|..||||..||.||.:.........|:.
Human    21 NLVNFHRMIKLTTGKEAALSYGFYGCHCGVGGRGSPKDATDRCCVTHDCCYKRLEKRGCGTKFLS 85

  Fly   307 YVWKCYRGKPLCAVDHGEFGGPDSCAARLCQCDLRLSRCLKR----------YYCPHRRSICHSS 361
            |.:.....:..||..       |||.::||:||...:.|..|          ||   ....|..|
Human    86 YKFSNSGSRITCAKQ-------DSCRSQLCECDKAAATCFARNKTTYNKKYQYY---SNKHCRGS 140

  Fly   362 RSR 364
            ..|
Human   141 TPR 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14507NP_001097964.1 PLA2c 243..357 CDD:153091 40/124 (32%)
PLA2G2ANP_000291.1 PLA2c 21..137 CDD:153091 40/125 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 76 1.000 Domainoid score I8954
eggNOG 1 0.900 - - E1_KOG4087
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1422829at2759
OrthoFinder 1 1.000 - - FOG0000342
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101872
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X246
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.720

Return to query results.
Submit another query.