DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14507 and PLA2G1B

DIOPT Version :9

Sequence 1:NP_001097964.1 Gene:CG14507 / 43461 FlyBaseID:FBgn0039655 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_000919.1 Gene:PLA2G1B / 5319 HGNCID:9030 Length:148 Species:Homo sapiens


Alignment Length:133 Identity:46/133 - (34%)
Similarity:62/133 - (46%) Gaps:20/133 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 RDVARLYSMIKC-STGCDPLI-YKGYGCYCGFGGHGVPADGIDRCCRVHDKCYGQS----NCISY 300
            |.|.:...|||| ..|.||.: |..||||||.||.|.|.|.:|:||:.||.||.|:    :|...
Human    22 RAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKCCQTHDNCYDQAKKLDSCKFL 86

  Fly   301 LE--YFVPYVWKCYRGKPLCAVDHGEFGGPDSCAARLCQCDLRLSRCLKR--YYCPHR----RSI 357
            |:  |...|.:.|......|:..:.|      |.|.:|.||...:.|..:  |...|:    :..
Human    87 LDNPYTHTYSYSCSGSAITCSSKNKE------CEAFICNCDRNAAICFSKAPYNKAHKNLDTKKY 145

  Fly   358 CHS 360
            |.|
Human   146 CQS 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14507NP_001097964.1 PLA2c 243..357 CDD:153091 43/127 (34%)
PLA2G1BNP_000919.1 PA2c 24..146 CDD:214508 43/127 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 76 1.000 Domainoid score I8954
eggNOG 1 0.900 - - E1_KOG4087
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5392
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1422829at2759
OrthoFinder 1 1.000 - - FOG0000342
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101872
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3674
SonicParanoid 1 1.000 - - X246
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.660

Return to query results.
Submit another query.