DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14507 and Lexm

DIOPT Version :9

Sequence 1:NP_001097964.1 Gene:CG14507 / 43461 FlyBaseID:FBgn0039655 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_001102732.1 Gene:Lexm / 500516 RGDID:1559493 Length:402 Species:Rattus norvegicus


Alignment Length:225 Identity:44/225 - (19%)
Similarity:68/225 - (30%) Gaps:92/225 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 IFPNISQSATAIDSP---------STIPPETSVKTSLMVSPQQDWQQMGLDGWTGELKPPVASLE 147
            :.||..:.:|..::|         |.|.|.|........|.:...|::|. ||        |..:
  Rat    25 VHPNQKKFSTFTEAPYSRHHSVELSHIGPGTYNSKETCFSKKFLEQKLGA-GW--------ARAQ 80

  Fly   148 QDHRDTRPPISWQNSYPHDEIRLEFQNHHFDGRVTDIRVITQTTSKPAEMEDLMNVQNVYIARVN 212
            :..|.|:.|                 :.||           |...|..|.:          |...
  Rat    81 EASRLTQLP-----------------HFHF-----------QAIKKEREQQ----------ANKR 107

  Fly   213 DPFGYSMKWSFTNDSSREKE----LLPEGDRGKRDVARLYSMIKCSTGCDPLIYKGYGCYCGFGG 273
            .|..|::| .|..:..::.:    ||..|:...|.:...|             |.|.|.|   |.
  Rat   108 GPGSYNIK-DFLTELQKKPQSKRGLLSSGETRFRGLIGNY-------------YPGPGNY---GE 155

  Fly   274 HGVP-------------ADGIDRCCRVHDK 290
            .|.|             :||:  .||:..|
  Rat   156 KGNPYTQLEKNSWNRSHSDGL--MCRLSSK 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14507NP_001097964.1 PLA2c 243..357 CDD:153091 13/61 (21%)
LexmNP_001102732.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4087
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.