DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14507 and PLA2G2C

DIOPT Version :9

Sequence 1:NP_001097964.1 Gene:CG14507 / 43461 FlyBaseID:FBgn0039655 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_001303651.1 Gene:PLA2G2C / 391013 HGNCID:9032 Length:150 Species:Homo sapiens


Alignment Length:88 Identity:27/88 - (30%)
Similarity:37/88 - (42%) Gaps:7/88 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 YKGYGCYCGFGGHGVPADGID--RCCRVHDKCYGQSNCISYLEYFVPYVWKCYRGKPLCAVDHGE 324
            |.|||||||.|..|:|.|..|  .....::| ..:.:|...|.   .|.:....|..:|....|.
Human    39 YYGYGCYCGLGDKGIPVDDTDSPSSPSPYEK-LKEFSCQPVLN---SYQFHIVNGAVVCGCTLGP 99

  Fly   325 FGGPDSCAARLCQCDLRLSRCLK 347
             |....|..:.|:||.:...|.|
Human   100 -GASCHCRLKACECDKQSVHCFK 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14507NP_001097964.1 PLA2c 243..357 CDD:153091 27/88 (31%)
PLA2G2CNP_001303651.1 Phospholip_A2_1 22..132 CDD:278496 27/88 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1422829at2759
OrthoFinder 1 1.000 - - FOG0000342
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.