DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14507 and Y69A2AL.2

DIOPT Version :9

Sequence 1:NP_001097964.1 Gene:CG14507 / 43461 FlyBaseID:FBgn0039655 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_001033458.1 Gene:Y69A2AL.2 / 3896813 WormBaseID:WBGene00044468 Length:157 Species:Caenorhabditis elegans


Alignment Length:130 Identity:42/130 - (32%)
Similarity:54/130 - (41%) Gaps:12/130 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 RLYSMIKCSTGCDPLIYKGYGCYCGFGGHGVPADGIDRCCRVHDKCYGQ----SNC-ISYLEYFV 305
            :|..|..|..|.....|:.|||.|.......|.|||||||:||:.||.:    ..| .|...||.
 Worm    22 QLDDMSYCRIGQPFDAYRYYGCSCSGISPNKPIDGIDRCCQVHNDCYNELLLTKKCQNSNSPYFC 86

  Fly   306 PYVWKCYRGKPLCAVDHGEFGGPDSCAARLCQCDLRLSRCLKRYYCPHRRSICHSSRSRRLQNLI 370
            .|.|:|...:|.|       .....|...:||||.:...||.:|..|.....|..|....:..:|
 Worm    87 LYKWECVYQQPAC-------NNESKCTQSVCQCDEQFINCLAKYPYPTFSKKCQYSERDPILKMI 144

  Fly   371  370
             Worm   145  144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14507NP_001097964.1 PLA2c 243..357 CDD:153091 39/115 (34%)
Y69A2AL.2NP_001033458.1 Phospholip_A2_1 22..131 CDD:278496 39/115 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4087
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1422829at2759
OrthoFinder 1 1.000 - - FOG0000342
OrthoInspector 1 1.000 - - otm14070
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11716
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3674
SonicParanoid 1 1.000 - - X246
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.910

Return to query results.
Submit another query.