DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14507 and sPLA2

DIOPT Version :9

Sequence 1:NP_001097964.1 Gene:CG14507 / 43461 FlyBaseID:FBgn0039655 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_001014501.1 Gene:sPLA2 / 35665 FlyBaseID:FBgn0033170 Length:186 Species:Drosophila melanogaster


Alignment Length:172 Identity:35/172 - (20%)
Similarity:56/172 - (32%) Gaps:60/172 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 FG-YSMKWSFTNDSSREKELLPEGDRGKRDVARLYSMIKCSTGCDPLIYKGYGC----YCGFGGH 274
            || .:|.|:|.:::..|.|             .:|:.     ...|:.:.|...    :||.|..
  Fly    10 FGLLAMAWAFGDEAIFEDE-------------DIYNQ-----ALPPVPHTGITVPGTKWCGPGNT 56

  Fly   275 GVPADGI------DRCCRVHDKCYGQSNCISYLEYFVPYVWKCYRGKPLCAVDHGEFGG----PD 329
            ....:.:      |:|||.||      :|...:|                  .||...|    .|
  Fly    57 AANFEDLGRERETDKCCRAHD------HCDEIIE------------------SHGALHGLPTNTD 97

  Fly   330 SCAARLCQCDLRLSRCLKRYYCPHRRS---ICHSSRSRRLQN 368
            ......|.|:.:...||:.......::   |.:.||||...|
  Fly    98 WFPILKCTCEQQFINCLQAVNSITAKTLGRIYYGSRSRCFAN 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14507NP_001097964.1 PLA2c 243..357 CDD:153091 22/130 (17%)
sPLA2NP_001014501.1 PLA2_bee_venom_like 43..139 CDD:153093 24/119 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1422829at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.