DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14507 and Pla2g2d

DIOPT Version :9

Sequence 1:NP_001097964.1 Gene:CG14507 / 43461 FlyBaseID:FBgn0039655 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_001013446.1 Gene:Pla2g2d / 298579 RGDID:1309862 Length:144 Species:Rattus norvegicus


Alignment Length:130 Identity:43/130 - (33%)
Similarity:54/130 - (41%) Gaps:27/130 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 LYSMIKCSTGCDPLI-YKGYGCYCGFGGHGVPADGIDRCCRVHDKCYGQ---SNCISYLEYFVPY 307
            |..|:...||..... |..|||:|||||.|.|.|..|.||:.||.||..   ..|.|..:   .|
  Rat    24 LNKMVNHMTGKKAFFSYWPYGCHCGFGGKGQPKDATDWCCQKHDCCYAHLKIDGCKSLTD---NY 85

  Fly   308 VWKCYRGKPLCAVDHGEFGGPDSCAARLCQCDLRLSRCLK----------RYY----CPHRRSIC 358
            .:....|...|: |.|.:     |..:||.||..::.|||          |||    |..:...|
  Rat    86 KYSISEGVIQCS-DQGSW-----CERQLCACDKEVALCLKQNLESYNKRLRYYWRPRCKGQTPTC 144

  Fly   359  358
              Rat   145  144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14507NP_001097964.1 PLA2c 243..357 CDD:153091 42/127 (33%)
Pla2g2dNP_001013446.1 PLA2c 20..137 CDD:153091 41/121 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4087
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1422829at2759
OrthoFinder 1 1.000 - - FOG0000342
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X246
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.