DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14507 and Pla2g2a

DIOPT Version :9

Sequence 1:NP_001097964.1 Gene:CG14507 / 43461 FlyBaseID:FBgn0039655 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_113786.3 Gene:Pla2g2a / 29692 RGDID:620857 Length:146 Species:Rattus norvegicus


Alignment Length:102 Identity:39/102 - (38%)
Similarity:49/102 - (48%) Gaps:11/102 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 MIKCSTG--CDPLIYKGYGCYCGFGGHGVPADGIDRCCRVHDKCYGQSNCISYLEYFVPYVWKCY 312
            ||...||  .| :.|..|||:||.||.|.|.|..|.||..||.||.:.........|:.|.:. |
  Rat    29 MILFKTGKRAD-VSYGFYGCHCGVGGRGSPKDATDWCCVTHDCCYNRLEKRGCGTKFLTYKFS-Y 91

  Fly   313 RGKPL-CAVDHGEFGGPDSCAARLCQCDLRLSRCLKR 348
            ||..: |:.:.      |||..:|||||...:.|..|
  Rat    92 RGGQISCSTNQ------DSCRKQLCQCDKAAAECFAR 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14507NP_001097964.1 PLA2c 243..357 CDD:153091 39/102 (38%)
Pla2g2aNP_113786.3 PA2c 22..139 CDD:214508 39/102 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 82 1.000 Domainoid score I8208
eggNOG 1 0.900 - - E1_KOG4087
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1422829at2759
OrthoFinder 1 1.000 - - FOG0000342
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101872
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X246
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.720

Return to query results.
Submit another query.