DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14507 and Pla2g2e

DIOPT Version :9

Sequence 1:NP_001097964.1 Gene:CG14507 / 43461 FlyBaseID:FBgn0039655 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_036174.1 Gene:Pla2g2e / 26970 MGIID:1349660 Length:142 Species:Mus musculus


Alignment Length:113 Identity:40/113 - (35%)
Similarity:49/113 - (43%) Gaps:13/113 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 MIKCSTGCDPLIYKGYGCYCGFGGHGVPADGIDRCCRVHDKCYG---QSNCISYLEYFVPYVWKC 311
            ||:..||...|.|..||||||.||...|.|..|.||..||.|||   :..|...||   .|::..
Mouse    27 MIERMTGKPALQYNDYGCYCGVGGSHWPVDETDWCCHAHDCCYGRLEKLGCDPKLE---KYLFSI 88

  Fly   312 YRGKPLCAVDHGEFGGPDSCAARLCQCDLRLSRCLKRYYCPHRRSICH 359
            .|....||       |..:|....|:||.|.:.|.:.....:.|...|
Mouse    89 TRDNIFCA-------GRTACQRHTCECDKRAALCFRHNLNTYNRKYAH 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14507NP_001097964.1 PLA2c 243..357 CDD:153091 39/109 (36%)
Pla2g2eNP_036174.1 Phospholip_A2_1 23..127 CDD:278496 39/109 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 80 1.000 Domainoid score I8561
eggNOG 1 0.900 - - E1_KOG4087
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000342
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101872
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X246
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.710

Return to query results.
Submit another query.