DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14507 and Pla2g10

DIOPT Version :9

Sequence 1:NP_001097964.1 Gene:CG14507 / 43461 FlyBaseID:FBgn0039655 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_036117.1 Gene:Pla2g10 / 26565 MGIID:1347522 Length:151 Species:Mus musculus


Alignment Length:111 Identity:44/111 - (39%)
Similarity:54/111 - (48%) Gaps:16/111 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 KRDVARLYSMIKCSTGCDPLIYKGYGCYCGFGGHGVPADGIDRCCRVHDKCYGQ---SNCISYLE 302
            ||.:..|...:.|.....|:.|..||||||.||||.|.|.||.||..||.||.:   :.|...|:
Mouse    27 KRGLLELAGTLDCVGPRSPMAYMNYGCYCGLGGHGEPRDAIDWCCYHHDCCYSRAQDAGCSPKLD 91

  Fly   303 YFVPYVWKCYRGKPLCAVDHGEFGGP--DSCAARLCQCDLRLSRCL 346
               .|.|||        :||....||  :.|...||:||..|:.||
Mouse    92 ---RYPWKC--------MDHHILCGPAENKCQELLCRCDEELAYCL 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14507NP_001097964.1 PLA2c 243..357 CDD:153091 42/109 (39%)
Pla2g10NP_036117.1 PLA2c 29..143 CDD:153091 42/109 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 80 1.000 Domainoid score I8561
eggNOG 1 0.900 - - E1_KOG4087
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1422829at2759
OrthoFinder 1 1.000 - - FOG0000342
OrthoInspector 1 1.000 - - oto93826
orthoMCL 1 0.900 - - OOG6_101872
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3674
SonicParanoid 1 1.000 - - X246
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.710

Return to query results.
Submit another query.