DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14507 and PLA2G2D

DIOPT Version :9

Sequence 1:NP_001097964.1 Gene:CG14507 / 43461 FlyBaseID:FBgn0039655 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_036532.1 Gene:PLA2G2D / 26279 HGNCID:9033 Length:145 Species:Homo sapiens


Alignment Length:127 Identity:45/127 - (35%)
Similarity:60/127 - (47%) Gaps:24/127 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 VARLYSMIKCSTGCDPLI-YKGYGCYCGFGGHGVPADGIDRCCRVHDKCYGQ---SNCISYLEYF 304
            :..|..|:|..||..|:: |..|||:||.||.|.|.|..|.||:.||.||..   ..|..|.:| 
Human    22 ILNLNKMVKQVTGKMPILSYWPYGCHCGLGGRGQPKDATDWCCQTHDCCYDHLKTQGCSIYKDY- 85

  Fly   305 VPYVWKCYRGKPLCAVDHGEFGGPDSCAARLCQCDLRLSRCLKR-----------YYCPHRR 355
              |.:...:|...|: |.|.:     |..:||.||..::.||||           |:.||.|
Human    86 --YRYNFSQGNIHCS-DKGSW-----CEQQLCACDKEVAFCLKRNLDTYQKRLRFYWRPHCR 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14507NP_001097964.1 PLA2c 243..357 CDD:153091 45/127 (35%)
PLA2G2DNP_036532.1 PLA2c 21..138 CDD:153091 43/124 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 76 1.000 Domainoid score I8954
eggNOG 1 0.900 - - E1_KOG4087
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1422829at2759
OrthoFinder 1 1.000 - - FOG0000342
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X246
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.