DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14507 and Lexm

DIOPT Version :9

Sequence 1:NP_001097964.1 Gene:CG14507 / 43461 FlyBaseID:FBgn0039655 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_899005.2 Gene:Lexm / 242602 MGIID:2681853 Length:414 Species:Mus musculus


Alignment Length:317 Identity:68/317 - (21%)
Similarity:99/317 - (31%) Gaps:125/317 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 PEMYGASMR---SANPSFVFKMPSKSNGGGDDFELLTMQRSDFAEPIFPNISQSATAIDSP---- 106
            |..:||..|   |..|.: ||        |..|.:.: .|.| ...::||..:.:|..::|    
Mouse     3 PRTHGAPPRNIMSTIPKW-FK--------GAPFGVQS-HRFD-VSAVYPNQKKFSTFTEAPYSRH 56

  Fly   107 -----STIPPETSVKTSLMVSPQQDWQQMGLDGWTGELKPPVASLEQDHRDTRPPISWQNSYPHD 166
                 |.|.|.|........|.:...|::| .||:           |.|..||     ....|| 
Mouse    57 HSVELSHIGPGTYNSKDTCFSKKFLEQKLG-SGWS-----------QAHEATR-----LTQLPH- 103

  Fly   167 EIRLEFQNHHFDGRVTDIRVITQTTSKPAEMEDLMNVQNVYIARVNDPFGYSMKWSFTNDSSREK 231
                    .|:           |...|..|.:          .....|..|::| .|..:..::.
Mouse   104 --------FHY-----------QAIKKEKEQQ----------VHKRGPGSYNIK-DFITELQKKP 138

  Fly   232 E----LLPEGDRGKRDVARLYSMIKCSTGCDPLIYKGYGCYCGFGGHGVP-------------AD 279
            :    ||..|:...|.....|             |.|.|.|   |..|.|             :|
Mouse   139 QSKRGLLSSGETRFRGFIGNY-------------YPGPGNY---GEKGNPYTQLEEKAWNRSHSD 187

  Fly   280 GIDRCCRVHDK--CYGQSNCI--------SYLEYFV--------PY-VWKCYRGKPL 317
            |:  .|||.:|  .:.|.:.:        |.||.||        || ::...|..||
Mouse   188 GL--MCRVSNKPPLFHQGSGLGPGTYTIKSDLETFVKKSTGNRGPYDIFSGERSSPL 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14507NP_001097964.1 PLA2c 243..357 CDD:153091 25/107 (23%)
LexmNP_899005.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4087
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.