DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14507 and Pla2g5

DIOPT Version :9

Sequence 1:NP_001097964.1 Gene:CG14507 / 43461 FlyBaseID:FBgn0039655 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_001116426.1 Gene:Pla2g5 / 18784 MGIID:101899 Length:137 Species:Mus musculus


Alignment Length:90 Identity:38/90 - (42%)
Similarity:50/90 - (55%) Gaps:13/90 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 YKGYGCYCGFGGHGVPADGIDRCCRVHDKCYGQ---SNCISYLEYFVPYVWKCYRGKPLCAVDHG 323
            |..||||||:||.|.|.||.|.||::||:||||   .:|....:   .|.::...|..:|  :|.
Mouse    41 YGFYGCYCGWGGRGTPKDGTDWCCQMHDRCYGQLEEKDCAIRTQ---SYDYRYTNGLVIC--EHD 100

  Fly   324 EFGGPDSCAARLCQCDLRLSRCLKR 348
            .|     |..|||.||.:|..||:|
Mouse   101 SF-----CPMRLCACDRKLVYCLRR 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14507NP_001097964.1 PLA2c 243..357 CDD:153091 38/90 (42%)
Pla2g5NP_001116426.1 PLA2c 21..137 CDD:153091 38/90 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4087
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1422829at2759
OrthoFinder 1 1.000 - - FOG0000342
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X246
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.