DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14507 and Pla2g2a

DIOPT Version :9

Sequence 1:NP_001097964.1 Gene:CG14507 / 43461 FlyBaseID:FBgn0039655 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_001076000.1 Gene:Pla2g2a / 18780 MGIID:104642 Length:146 Species:Mus musculus


Alignment Length:134 Identity:43/134 - (32%)
Similarity:60/134 - (44%) Gaps:27/134 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 DVARLYSMIKCSTG-CDPLIYKGYGCYCGFGGHGVPADGIDRCCRVHDKCY---GQSNCISYLEY 303
            ::|:...||:..|| ...|.|..|||:||.||.|.|.|..||||..||.||   .:|.|.:.|  
Mouse    22 NIAQFGEMIRLKTGKRAELSYAFYGCHCGLGGKGSPKDATDRCCVTHDCCYKSLEKSGCGTKL-- 84

  Fly   304 FVPYVWKCYRGKPLCAVDHGEFGGPDSCAARLCQCDLRLSRCLKR--------------YYCPHR 354
             :.|.:....|:..|:.:.      :||..||||||...:.|..|              .:|..:
Mouse    85 -LKYKYSHQGGQITCSANQ------NSCQKRLCQCDKAAAECFARNKKTYSLKYQFYPNMFCKGK 142

  Fly   355 RSIC 358
            :..|
Mouse   143 KPKC 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14507NP_001097964.1 PLA2c 243..357 CDD:153091 42/131 (32%)
Pla2g2aNP_001076000.1 PA2c 22..139 CDD:214508 41/125 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 80 1.000 Domainoid score I8561
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000342
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X246
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.