DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14507 and Pla2g1b

DIOPT Version :9

Sequence 1:NP_001097964.1 Gene:CG14507 / 43461 FlyBaseID:FBgn0039655 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_035237.1 Gene:Pla2g1b / 18778 MGIID:101842 Length:146 Species:Mus musculus


Alignment Length:115 Identity:40/115 - (34%)
Similarity:58/115 - (50%) Gaps:14/115 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 RDVARLYSMIKCS-TGCDPL-IYKGYGCYCGFGGHGVPADGIDRCCRVHDKCYGQSNCISYLEYF 304
            |.|.:..:||||: .|.||| .|..||||||.||.|.|.|.:||||:.||.||.|:..:...::.
Mouse    22 RAVWQFRNMIKCTIPGSDPLKDYNNYGCYCGLGGWGTPVDDLDRCCQTHDHCYSQAKKLESCKFL 86

  Fly   305 V--PYV----WKCYRGKPLCAVDHGEFGGPDSCAARLCQCDLRLSRCLKR 348
            :  ||.    :.|...:..|:..:      :.|...:|.||...:.|..:
Mouse    87 IDNPYTNTYSYSCSGSEITCSAKN------NKCEDFICNCDREAAICFSK 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14507NP_001097964.1 PLA2c 243..357 CDD:153091 39/114 (34%)
Pla2g1bNP_035237.1 PA2c 24..146 CDD:214508 39/113 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 80 1.000 Domainoid score I8561
eggNOG 1 0.900 - - E1_KOG4087
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5392
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1422829at2759
OrthoFinder 1 1.000 - - FOG0000342
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101872
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X246
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.630

Return to query results.
Submit another query.