DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14507 and Oc90

DIOPT Version :9

Sequence 1:NP_001097964.1 Gene:CG14507 / 43461 FlyBaseID:FBgn0039655 Length:373 Species:Drosophila melanogaster
Sequence 2:XP_011243790.1 Gene:Oc90 / 18256 MGIID:1313269 Length:486 Species:Mus musculus


Alignment Length:277 Identity:66/277 - (23%)
Similarity:101/277 - (36%) Gaps:67/277 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 ISQSATAIDSPSTIP--PETSVKTSLMVSPQ------QDWQQMGLDG-WTGELKPPVASLEQDHR 151
            |:.|...:|:...:|  |||:...:..:.|:      .|..|:.|.| ..||::          .
Mouse   177 INSSLNFLDASFCLPQTPETTSGKAATLLPRGIPEKPTDTSQIALSGEVAGEVR----------A 231

  Fly   152 DTRPPISWQNSYPHDEIRLEFQNHHFDGRVTDIR--VITQTTSKPAEMEDLMNVQNVYIARVNDP 214
            ||...:|...|                  |.|::  ..::|||.|...|.:...:....:....|
Mouse   232 DTLTTLSRTKS------------------VQDLQDTQASRTTSSPGSAEIIALAKGTTHSAGIKP 278

  Fly   215 FGYSMKWSFTNDSSREKELLPEGDR------GKRD----VARLYSMIKCSTGCDPLIYKGYGCYC 269
            ....:  |..::.|:|.......||      |..|    :.:|..|:.|.|...|..::.|||||
Mouse   279 LRLGV--SSVDNGSQEAAGKAACDRLAFVHLGDGDSMTAMLQLGEMLFCLTSHCPEEFETYGCYC 341

  Fly   270 GFGGHGVPADGIDRCCRVHDKCYGQSNCISYLEYFVPYVWKCYRGK----PLCAVDH-GEFGGPD 329
            |..|.|.|.|.:||||..|..|..|...:.           |..|:    .:...|| .:..|..
Mouse   342 GREGRGEPRDTLDRCCLSHHCCLEQMRQVG-----------CLHGRRSQSSVVCEDHMAKCVGQS 395

  Fly   330 SCAARLCQCDLRLSRCL 346
            .|...||.||...:.|:
Mouse   396 LCEKLLCACDQMAAECM 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14507NP_001097964.1 PLA2c 243..357 CDD:153091 34/113 (30%)
Oc90XP_011243790.1 otoconin_90 77..194 CDD:153096 4/16 (25%)
otoconin_90 318..433 CDD:153096 33/106 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4087
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1422829at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.