DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14507 and C07E3.9

DIOPT Version :9

Sequence 1:NP_001097964.1 Gene:CG14507 / 43461 FlyBaseID:FBgn0039655 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_496228.1 Gene:C07E3.9 / 182374 WormBaseID:WBGene00007419 Length:153 Species:Caenorhabditis elegans


Alignment Length:118 Identity:40/118 - (33%)
Similarity:56/118 - (47%) Gaps:11/118 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 LYSMIKCSTGCDPLIYKGYGCYCGFGGHGVPADGIDRCCRVHDKCY----GQSNCISY-LEYFVP 306
            |..:.:|....:.|.|..|||:||.||...|.||||.||..|||||    ....|:.. :||...
 Worm    29 LEEVAECELHYNALHYNNYGCWCGIGGSHEPVDGIDECCMHHDKCYDAAVDNKVCMDVEIEYVDD 93

  Fly   307 YVWKCYRGKPLCAVDHGEFGGPDSCAARLCQCDLRLSRCLKRYYCPHRRSICH 359
            |.|.|.....:|:..:      ..|.|.||.||..:..|.|::..|.:::.|:
 Worm    94 YSWSCMNSTAICSDKN------MGCKAALCDCDKIVVECWKKFPKPEKKAKCN 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14507NP_001097964.1 PLA2c 243..357 CDD:153091 39/114 (34%)
C07E3.9NP_496228.1 PLA2c 25..131 CDD:153091 38/107 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 86 1.000 Domainoid score I5153
eggNOG 1 0.900 - - E1_KOG4087
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5392
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1422829at2759
OrthoFinder 1 1.000 - - FOG0000342
OrthoInspector 1 1.000 - - otm14070
orthoMCL 1 0.900 - - OOG6_101872
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3674
SonicParanoid 1 1.000 - - X246
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.660

Return to query results.
Submit another query.