DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14507 and AgaP_AGAP011569

DIOPT Version :9

Sequence 1:NP_001097964.1 Gene:CG14507 / 43461 FlyBaseID:FBgn0039655 Length:373 Species:Drosophila melanogaster
Sequence 2:XP_309938.3 Gene:AgaP_AGAP011569 / 1271189 VectorBaseID:AGAP011569 Length:137 Species:Anopheles gambiae


Alignment Length:116 Identity:27/116 - (23%)
Similarity:39/116 - (33%) Gaps:45/116 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 YCGFGGHGVP-------ADGIDRCCRVHDKCYGQSNCISYLEYFVPYV---WKCYRGKPLCAVDH 322
            :|| .||...       |...|.|||.||.|          :|.:|.:   ::.:..:|. .:.|
Mosquito    16 WCG-KGHSASEYRQLGGASRADMCCRTHDHC----------KYMIPPMSTNFQTFNIRPF-TISH 68

  Fly   323 GEFGGPDSCAARLCQCDLRLSRCLKRYYCPHRRSICHSSRSRRLQNLIFFD 373
                         |.||.|...|||          ...|:...|...:||:
Mosquito    69 -------------CACDSRFRTCLK----------LADSKDANLVGKLFFN 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14507NP_001097964.1 PLA2c 243..357 CDD:153091 23/98 (23%)
AgaP_AGAP011569XP_309938.3 Phospholip_A2_2 12..105 CDD:283483 27/116 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1422829at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.