DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14507 and LOC116407767

DIOPT Version :9

Sequence 1:NP_001097964.1 Gene:CG14507 / 43461 FlyBaseID:FBgn0039655 Length:373 Species:Drosophila melanogaster
Sequence 2:XP_031749614.1 Gene:LOC116407767 / 116407767 -ID:- Length:203 Species:Xenopus tropicalis


Alignment Length:182 Identity:51/182 - (28%)
Similarity:75/182 - (41%) Gaps:35/182 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 VYIARVNDPF---GYSMK---------WSFTNDSSREKELLPEGDRGKRDVARLYSMIKCSTGCD 258
            ::|.:..:|.   .|||:         :|..|....::.:|.     :|.:.:|...|:|.||..
 Frog    27 IWIEQTREPLPGGNYSMELRIVALVFLFSSLNGELNKRHILQ-----RRGLIQLAGTIQCGTGRS 86

  Fly   259 PLIYKGYGCYCGFGGHGVPADGIDRCCRVHDKCYGQSNCISYLEYFVPYVWKCYRGKPLCAVDHG 323
            .:.|.||||:||.||.|||.|..|.||..||.||..:...........|.|.|......|    |
 Frog    87 AVHYIGYGCHCGLGGQGVPKDNTDWCCHSHDCCYEFAEKYGCKTKLGQYSWTCKDNTVKC----G 147

  Fly   324 EFGGPDSCAARLCQCDLRLSRCLKR------------YYCPHRRSICHSSRS 363
            :.  .|.|...:|:||.:.:.||.:            ..|..|...|.||::
 Frog   148 DM--KDWCQKIVCKCDSKFAECLSKTRFNSKHILYPNLLCKKRTPSCRSSKN 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14507NP_001097964.1 PLA2c 243..357 CDD:153091 39/125 (31%)
LOC116407767XP_031749614.1 PLA2c 71..185 CDD:153091 37/119 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 80 1.000 Domainoid score I8475
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000342
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X246
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.