DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14507 and pla2g1bl

DIOPT Version :9

Sequence 1:NP_001097964.1 Gene:CG14507 / 43461 FlyBaseID:FBgn0039655 Length:373 Species:Drosophila melanogaster
Sequence 2:XP_012809063.1 Gene:pla2g1bl / 105945485 XenbaseID:XB-GENE-22065804 Length:150 Species:Xenopus tropicalis


Alignment Length:143 Identity:47/143 - (32%)
Similarity:75/143 - (52%) Gaps:19/143 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 LPEGDRGKRDVARLYSMIKCS-TGCDPLI-YKGYGCYCGFGGHGVPADGIDRCCRVHDKCYGQ-- 294
            ||.  |..|::|:..::|||: .|..||: :..||||||.||.|.|.|.:||||::||.||.:  
 Frog    18 LPH--RQSRNLAQFSNIIKCAIPGSQPLLEFNDYGCYCGLGGSGTPVDELDRCCQIHDNCYDKAS 80

  Fly   295 --SNCISYLE--YFVPYVWKCYRGKPL-CAVDHGEFGGPDSCAARLCQCDLRLSRCLKRYYCPHR 354
              :||:..|:  |...|.:.|.....: |..::.|      |...:|:||:..:.|..|  .|:.
 Frog    81 LINNCVPVLQNPYTETYSYTCTDNNMMSCNKNNSE------CDMHICKCDMNAALCFSR--APYS 137

  Fly   355 RSICHSSRSRRLQ 367
            :...|..:::..|
 Frog   138 KKHKHLEKAKHCQ 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14507NP_001097964.1 PLA2c 243..357 CDD:153091 41/122 (34%)
pla2g1blXP_012809063.1 PA2c 25..149 CDD:214508 42/131 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1422829at2759
OrthoFinder 1 1.000 - - FOG0000342
OrthoInspector 1 1.000 - - oto104046
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X246
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.