DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14507 and pla2g2d

DIOPT Version :9

Sequence 1:NP_001097964.1 Gene:CG14507 / 43461 FlyBaseID:FBgn0039655 Length:373 Species:Drosophila melanogaster
Sequence 2:XP_031762319.1 Gene:pla2g2d / 100499402 XenbaseID:XB-GENE-996165 Length:147 Species:Xenopus tropicalis


Alignment Length:97 Identity:35/97 - (36%)
Similarity:47/97 - (48%) Gaps:23/97 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 YKGYGCYCGFGGHGVPADGIDRCCRVHDKCYGQS---NCISYLEYFVPYVWKCY-----RGKPLC 318
            |..|||:|||||.|.|.|.||.||.|||.|:|::   .|..        .||.|     .|...|
 Frog    42 YAFYGCHCGFGGQGPPTDEIDWCCHVHDCCFGRTANMGCNP--------KWKRYDFHFVNGTVTC 98

  Fly   319 -AVDHGEFGGPDSCAARLCQCDLRLSRCLKRY 349
             :.::.|      ||.:.|:||...:.|.|::
 Frog    99 NSTENSE------CAQQACECDREAALCFKQH 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14507NP_001097964.1 PLA2c 243..357 CDD:153091 35/97 (36%)
pla2g2dXP_031762319.1 PLA2c 22..140 CDD:153091 35/97 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1422829at2759
OrthoFinder 1 1.000 - - FOG0000342
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X246
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.