DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14507 and scfd1

DIOPT Version :9

Sequence 1:NP_001097964.1 Gene:CG14507 / 43461 FlyBaseID:FBgn0039655 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_001135508.1 Gene:scfd1 / 100216048 XenbaseID:XB-GENE-941809 Length:632 Species:Xenopus tropicalis


Alignment Length:270 Identity:58/270 - (21%)
Similarity:101/270 - (37%) Gaps:73/270 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 IRSAFRGVTNDTELLNHIIPEMYGASMRSANPSFVFKMPSKSNGGGDDFE-----LLTMQRS-DF 88
            ||.| ||  |..|::...:.:....::|.|..|..    :..|.|...|.     |:.:.|: |.
 Frog   200 IRCA-RG--NAAEMVAVKLDKKLRENLRDARNSLF----TGDNLGAGQFSFQRPLLVLVDRNIDL 257

  Fly    89 AEPIF-------------------PNISQSATAIDSPSTIPPETSVKTSL-MVSPQQDWQQMGLD 133
            |.|:.                   .|:.::.....|||...|:...|.|. :....:.||:    
 Frog   258 ATPLHHTWTYQALVHDVLDFHLNRVNLEEAPAVESSPSGARPKKKNKKSYDLTVADKFWQK---- 318

  Fly   134 GWTGELKPPVA-SLEQDHRDTRPPISWQNSYPHDEIR-------LEFQNHHFDGRVTD--IRVIT 188
             ..|...|.|| |::|:....|.        ..||::       ||.::......::|  .::.:
 Frog   319 -HKGSPFPEVAESVQQELESYRT--------QEDEVKRLKTIMGLEGEDEGAISMISDNTAKLTS 374

  Fly   189 QTTSKPAEME-----DL-MNV-----QNVYIARVNDPFGYSMKWSFTNDSSREKELL---PEGDR 239
            ..:|.|..:|     || .||     :::...:::..|.|..|  ..:.|:.:|.||   .:.|.
 Frog   375 AVSSLPELLEKKRLIDLHTNVATAVLEHIKTRKLDVYFEYEEK--LMSKSNLDKSLLDIISDPDA 437

  Fly   240 G-KRDVARLY 248
            | ..|..||:
 Frog   438 GTPEDKMRLF 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14507NP_001097964.1 PLA2c 243..357 CDD:153091 3/6 (50%)
scfd1NP_001135508.1 Sec1 34..619 CDD:366407 58/270 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4087
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.