DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Brd8 and GCN5

DIOPT Version :9

Sequence 1:NP_651685.2 Gene:Brd8 / 43460 FlyBaseID:FBgn0039654 Length:872 Species:Drosophila melanogaster
Sequence 2:NP_011768.1 Gene:GCN5 / 853167 SGDID:S000003484 Length:439 Species:Saccharomyces cerevisiae


Alignment Length:555 Identity:104/555 - (18%)
Similarity:176/555 - (31%) Gaps:159/555 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   310 ASTTPTLERSPSQAAPTLSMLLEKNMAAAKANESGSLVKPEGSGNQEQGVDEATSSAAGTADSDE 374
            |:|.|.::|          :.||.|:...:. |.....|.||:..:.:|..|..:...|.:    
Yeast    15 ATTDPEVKR----------VKLENNVEEIQP-EQAETNKQEGTDKENKGKFEKETERIGGS---- 64

  Fly   375 ADPNEAQLLEVFKNIDQIIDDIDID--------MASVIDDEILKNVDDVVASPSNDKAEVIDFED 431
                     ||..::::.|...:.|        ..||:::...| ::..|.:..|.|..::    
Yeast    65 ---------EVVTDVEKGIVKFEFDGVEYTFKERPSVVEENEGK-IEFRVVNNDNTKENMM---- 115

  Fly   432 KLDALKREQSKSSPASDKPKSVELVIGSSDDSNDNI--PLAAVASQESKDRGQSGGESTRGTEDA 494
            .|..||....|..|...|.....||...|..|...|  ||..|           ||.:.|..:. 
Yeast   116 VLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAVIRKPLTVV-----------GGITYRPFDK- 168

  Fly   495 ESEPLTSEVAVEEIGETITIISTSSEDTAGSPPTKMEEDGATDSLPKKEDAAEDKSEQESSSQGQ 559
                       .|..|.:....:|:|...|.....|..  ..|.:....:.....:..::.:.|.
Yeast   169 -----------REFAEIVFCAISSTEQVRGYGAHLMNH--LKDYVRNTSNIKYFLTYADNYAIGY 220

  Fly   560 NKAGGSTDEPELIDHQATREAQSKSGKDTAGKPVTMQEKTTTQSAPVPVDLHDTDEESSSLTDSS 624
            .|..|.|.|                  .|..|.:.|.              :..|.|..:|...|
Yeast   221 FKKQGFTKE------------------ITLDKSIWMG--------------YIKDYEGGTLMQCS 253

  Fly   625 -----KHDDHPRSAKAKPPALKLALDD-SKSELELSGTPQ-------PPSAPARTPLLRKLPHRD 676
                 ::.|..:....:..||:..:.. |||.:...|..|       .|..|...|.|::     
Yeast   254 MLPRIRYLDAGKILLLQEAALRRKIRTISKSHIVRPGLEQFKDLNNIKPIDPMTIPGLKE----- 313

  Fly   677 RSESPMVDDDATTASDHSTARSTRRRCSSTPVIDSIPNSPASSEHTDDRRETRAASKKLFLSIYA 741
                                      ...||.:|::...|....|.       ||.:.:...:  
Yeast   314 --------------------------AGWTPEMDALAQRPKRGPHD-------AAIQNILTEL-- 343

  Fly   742 MLLDSKHAA--PFKRPFHDEHAQRHADLCLRPMDFPTIKRNIDSGFIRSLSELHRDVLLMAHNVL 804
                ..|||  ||.:|.:.|....:.|....|||..|::..::|...:.:.:...|..|:.:|..
Yeast   344 ----QNHAAAWPFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVFNNCR 404

  Fly   805 VAYKPHTAQHKTA----RLFVQDCQAIKEFSQLPD 835
            :....:|:.:|.|    :.|....:.|.|:|.|.|
Yeast   405 MYNGENTSYYKYANRLEKFFNNKVKEIPEYSHLID 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Brd8NP_651685.2 PaaSYMP <105..188 CDD:291408
PHA03249 402..>582 CDD:223023 35/181 (19%)
Bromo_brd8_like 729..833 CDD:99939 25/109 (23%)
GCN5NP_011768.1 COG5076 77..439 CDD:227408 86/467 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.