DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Brd8 and tbrd-3

DIOPT Version :9

Sequence 1:NP_651685.2 Gene:Brd8 / 43460 FlyBaseID:FBgn0039654 Length:872 Species:Drosophila melanogaster
Sequence 2:NP_726307.1 Gene:tbrd-3 / 246604 FlyBaseID:FBgn0050417 Length:268 Species:Drosophila melanogaster


Alignment Length:164 Identity:42/164 - (25%)
Similarity:64/164 - (39%) Gaps:52/164 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   725 RRETRAAS----------KKLFLSIYAMLLDSKHAAPFKRP-------FHDEHAQRHADLCLRPM 772
            ::||..:|          |:||.|.|..:     |..|..|       .||.|     ::...||
  Fly     4 KQETERSSPEINACKVIIKRLFSSTYKNI-----AWVFYEPLDPQLLGLHDYH-----EIVREPM 58

  Fly   773 DFPTIKRNIDSGFIRSLSELHRDVLLMAHNVLVAYKP-HTAQHKTARLFVQDCQAIKE--FSQLP 834
            |..|::..:::|...|.::..:|:.|:.:|..:...| |...|...:|     |.|.|  :||  
  Fly    59 DLSTVRHRLNTGCYLSAADFAKDIRLIFYNTYLYTNPDHLCYHMAKQL-----QIIFEEMYSQ-- 116

  Fly   835 DVQAGITATPVSNTGSLRADKSSGSKARSGSRKS 868
             ||..|.              |||||.|:....|
  Fly   117 -VQLYIC--------------SSGSKVRAEEESS 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Brd8NP_651685.2 PaaSYMP <105..188 CDD:291408
PHA03249 402..>582 CDD:223023
Bromo_brd8_like 729..833 CDD:99939 29/123 (24%)
tbrd-3NP_726307.1 Bromo_Brdt_II_like 13..114 CDD:99930 27/115 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.