DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Brd8 and C29F9.5

DIOPT Version :9

Sequence 1:NP_651685.2 Gene:Brd8 / 43460 FlyBaseID:FBgn0039654 Length:872 Species:Drosophila melanogaster
Sequence 2:NP_001355379.1 Gene:C29F9.5 / 183022 WormBaseID:WBGene00016220 Length:261 Species:Caenorhabditis elegans


Alignment Length:248 Identity:53/248 - (21%)
Similarity:94/248 - (37%) Gaps:52/248 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SAGVQERLQLSRMPLDTWSKREQLILASAVSCSGDQNWITVSRTLKTICGNGSSNRPADWFSQKN 66
            |..||::.::|...::|...|:..:|..|..|        |.|.:| |......|.||   ....
 Worm    22 SDNVQQQPRVSTATMNTLISRQLGLLLHAHEC--------VRRDIK-IREAAEKNEPA---PHAM 74

  Fly    67 CAMQYGNLLESV--EATKRKKRSSESSAGVSSPATV----------ETPT-ELLLRRLTEERQAE 118
            |.:|...:::.|  ..|..|:....:|...:|..|:          |.|. :.::.:.|...|..
 Worm    75 CKIQDCVIMKEVLKHMTSCKEGPKCNSVHCASSRTILSHWKKCFNEECPVCKPIIEQRTAPPQDT 139

  Fly   119 IKAQMRQ---DQ-------ETYR-----RIQREIESLQSDAVTEQELQDMWLEIEKEQE------ 162
            ..|:.::   ||       :|||     :|.:.|.|........:...|.|.|..:..|      
 Worm   140 TPAEPKKPEHDQIWHLEVPKTYRSELIEKIYKGIMSNVKPGTLSEAQMDTWKEYSRSAELQIFDT 204

  Fly   163 ARRIE---EMKLENRMREREQRKKDLASNWRNSSLAVKRSNQAADT---TSVD 209
            |:::|   .|..|...|.:|...:...:..::.|...::.::|.|.   ||.|
 Worm   205 AQKLEAYYHMAREKVCRYQEGFPRRQKTEEKDESDGSEKEDEADDRLEGTSTD 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Brd8NP_651685.2 PaaSYMP <105..188 CDD:291408 21/106 (20%)
PHA03249 402..>582 CDD:223023
Bromo_brd8_like 729..833 CDD:99939
C29F9.5NP_001355379.1 ZnF_TAZ 40..128 CDD:214717 21/99 (21%)
KIX 153..223 CDD:280354 15/69 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.