DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cisd2 and NEET

DIOPT Version :9

Sequence 1:NP_651684.1 Gene:Cisd2 / 43459 FlyBaseID:FBgn0062442 Length:133 Species:Drosophila melanogaster
Sequence 2:NP_568764.1 Gene:NEET / 835246 AraportID:AT5G51720 Length:108 Species:Arabidopsis thaliana


Alignment Length:108 Identity:42/108 - (38%)
Similarity:59/108 - (54%) Gaps:12/108 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LALIPPTVVVAGLGYTAYLAYCPAARASCA----------AKNSGRCNNHIRKNEPKVVDMIDVE 91
            :|:|..| ...||.|...|.:.|.......          |:..|..|..|||||.||||.:.|.
plant     1 MAIIAST-FGTGLSYAGELPFKPVTGGEVGRKQQRMVVVRAEGGGGINPEIRKNEDKVVDSVVVT 64

  Fly    92 DIAEK-AAFCRCWKTKNWPYCDGSHGEHNKQTGDNVGPIVIKK 133
            ::::. ..:||||::..:|.|||||.:|||..||||||:::||
plant    65 ELSKNITPYCRCWRSGTFPLCDGSHVKHNKANGDNVGPLLLKK 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cisd2NP_651684.1 MitoNEET_N 1..62 CDD:287613 8/24 (33%)
ZnF_CDGSH 83..121 CDD:197836 17/38 (45%)
NEETNP_568764.1 zf-CDGSH <73..94 CDD:413457 11/20 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3461
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I2374
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1393750at2759
OrthoFinder 1 1.000 - - FOG0002260
OrthoInspector 1 1.000 - - oto3048
orthoMCL 1 0.900 - - OOG6_103419
Panther 1 1.100 - - LDO PTHR13680
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1493
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.830

Return to query results.
Submit another query.