DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cisd2 and Cisd1

DIOPT Version :9

Sequence 1:NP_651684.1 Gene:Cisd2 / 43459 FlyBaseID:FBgn0062442 Length:133 Species:Drosophila melanogaster
Sequence 2:NP_598768.1 Gene:Cisd1 / 52637 MGIID:1261855 Length:108 Species:Mus musculus


Alignment Length:101 Identity:44/101 - (43%)
Similarity:66/101 - (65%) Gaps:9/101 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 DWLALIPPTVVVAGLGYTAYLAYCPAARASCAAKNSGRC--NNHIRKNEPKVVDMIDVEDIAEKA 97
            :|:|.:......|.|||.||..:       .|.:|..:.  |..|:|:.||||...|:||:.:||
Mouse    12 EWIAAVTFAAGTAALGYLAYKKF-------YAKENRTKAMVNLQIQKDNPKVVHAFDMEDLGDKA 69

  Fly    98 AFCRCWKTKNWPYCDGSHGEHNKQTGDNVGPIVIKK 133
            .:||||::|.:|:|||:|.:||::|||||||::|||
Mouse    70 VYCRCWRSKKFPFCDGAHIKHNEETGDNVGPLIIKK 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cisd2NP_651684.1 MitoNEET_N 1..62 CDD:287613 8/26 (31%)
ZnF_CDGSH 83..121 CDD:197836 20/37 (54%)
Cisd1NP_598768.1 MitoNEET_N <12..41 CDD:313801 10/35 (29%)
ZnF_CDGSH 55..93 CDD:197836 20/37 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845478
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3461
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1393750at2759
OrthoFinder 1 1.000 - - FOG0002260
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103419
Panther 1 1.100 - - LDO PTHR13680
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4512
SonicParanoid 1 1.000 - - X1493
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.740

Return to query results.
Submit another query.