DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cisd2 and cisd2

DIOPT Version :9

Sequence 1:NP_651684.1 Gene:Cisd2 / 43459 FlyBaseID:FBgn0062442 Length:133 Species:Drosophila melanogaster
Sequence 2:XP_012816909.2 Gene:cisd2 / 496970 XenbaseID:XB-GENE-5969737 Length:136 Species:Xenopus tropicalis


Alignment Length:107 Identity:44/107 - (41%)
Similarity:66/107 - (61%) Gaps:5/107 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEPISHLVKSSLPNYLSSLPVPDSIGGWFKLSFKDWLALIPPTVVVAGLGYTAYLAYCPAARASC 65
            :|.|:.::|..||.||..||:||||.|:.:|:..:||.|:|...|:|.|||.|...:.|..:   
 Frog     3 LESIARVIKVQLPAYLKRLPIPDSIAGFIRLTVSEWLRLLPFLGVLALLGYLAIRPFLPKKK--- 64

  Fly    66 AAKNSGRCNNHIRKNEPKVVDMIDVEDI-AEKAAFCRCWKTK 106
             .:.....|..|:|..||||:.|::||: ..|||:||||::|
 Frog    65 -QQKDSLINLKIQKENPKVVNEINIEDLHLAKAAYCRCWRSK 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cisd2NP_651684.1 MitoNEET_N 1..62 CDD:287613 26/60 (43%)
ZnF_CDGSH 83..121 CDD:197836 14/25 (56%)
cisd2XP_012816909.2 MitoNEET_N 3..66 CDD:313801 26/66 (39%)
zf-CDGSH 81..>106 CDD:413457 14/25 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I10713
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H36436
Inparanoid 1 1.050 130 1.000 Inparanoid score I4514
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1393750at2759
OrthoFinder 1 1.000 - - FOG0002260
OrthoInspector 1 1.000 - - otm47775
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4512
SonicParanoid 1 1.000 - - X1493
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.000

Return to query results.
Submit another query.